DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: atp11c and CG33298

Sequence 1:XP_009289452.1 Gene:atp11c ZFINID:ZDB-GENE-030616-51 Length:1139 Species:Danio rerio
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1339 Identity:386/1340 (29%)
Similarity:609/1340 (45%) Gaps:331/1340 (25%)


Zfish     4 RRLNRLCG---GDERRVDS-RTIYVGHRPCPDTEAFIPPK----------FCDNRIVSSKYTVWN 54
            :||. ||.   ||:....| ||:...|.        :|||          |..|:|.::|||:.:
  Fly   209 KRLT-LCNYNTGDKFEERSYRTVVPNHT--------VPPKTPKRDHPNGQFVGNKIRTTKYTLLS 264

Zfish    55 FLPKNLFEQFRRIANFYFLIIFLVQVIVD-TPTSPVTSGLPLFFVITVTAIKQGYEDWLRHKADN 118
            |:||||.|||.|:||.||:.|.|:..:.: :......:.:|:.||:.|||:|..:||..|..:|.
  Fly   265 FIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVTAVKDLFEDRRRRASDK 329

Zfish   119 EVNKYPVTVL--EDGRSVKKESEKIKVGDVVEVVEDETFPCDLILLQSSREDGTCFVTTASLDGE 181
            .:|.....|.  |..|..|.:.::::|||:|.:..:||.|.|::||::|...|.|::.|..||||
  Fly   330 RINNTTCRVYDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGE 394

Zfish   182 SNHKTHYTVPDIERDLQVL------TAAIECEQPQPDLYKFVGRMHIYKPEQEEAVRSLGPENLL 240
            :|.|....|...| ::|.:      .:.:|.:.|...||:|.|.  :..|..|..  .:..|.||
  Fly   395 TNLKRREVVRGFE-EMQSIFVPSKFVSRVEADAPTTKLYRFHGA--LIHPTGERV--PISTECLL 454

Zfish   241 LKGATLKNTKEIYGVAVYTGMETKMALNYQGKSQKRSAVEKSIN------AFLLVYLCILISKAV 299
            |:.:.||||..|.|:.||.|.|||..||..|...|||.||:.:|      ..:|:.||::  .|:
  Fly   455 LRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVV--GAI 517

Zfish   300 VCTTLKYVWQSKEGQ-DEPWYNEKTQKEKETNMYLKMFTDFLSFMVLFNFIIPVSMYVTVEMQKF 363
            .|.    :|.|.... ..|:...........:|::     |.:::|:...:||:|:|||:|:.|.
  Fly   518 GCR----MWLSSFTHFPVPYLPPNKLTANMESMWI-----FWTYIVILQVMIPLSLYVTIELCKI 573

Zfish   364 LGSFFIKWDNDFFDPEIEEGALVNTSDLNEELGQVEYVFTDKTGTLTQNNMEFIECCIDGFQYRH 428
            |..|.|..:.|.||.|..:.......::.|||||::::|||||||||:|.|.|..|.::|..|.|
  Fly   574 LQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNH 638

Zfish   429 RDAHGELDGFTVTDGPLNKLQEKAG----------------------------REKEELFLRALC 465
            ..:.            |.|:..|.|                            .::.:.||..|.
  Fly   639 PPSE------------LEKIYSKPGAPAPPLIPNDNLNSDMAQLTQGTYLTPHAQRIQEFLVVLA 691

Zfish   466 LCHTVQV---------------------------------------------------------- 472
            :|:||.|                                                          
  Fly   692 ICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLASSTSTTTTTTIINGPTTQPQ 756

Zfish   473 -------------------------------------------------------------KEET 476
                                                                         |.::
  Fly   757 VVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISSSAESSPNSESESPSPPMKNKS 821

Zfish   477 LSDQI-------------------------DGIDGVLPK---------AEEERGFIASSPDEVAL 507
            ||:.|                         .|....||.         |:....:.|.||||:||
  Fly   822 LSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRTADGRPLYEAESPDELAL 886

Zfish   508 VKGAMEYGFTFLGLE-NKNMKIRNRQNDIEEYKLLHVLNFDPVRRRMSVIV-QTKSGDTLLFCKG 570
            |..|..|....|... |:.:..........||::|.||.||..|:.||::| |..|.:.:|:.||
  Fly   887 VNAAYSYDCCLLNRSPNQILVSMPMAGATREYEILKVLPFDSSRKCMSIVVRQIGSQEIVLYTKG 951

Zfish   571 ADSSIFPRVRP-----------EEVDRIRLHVERNATDGYRTLCVAYKQLSAEEYALADTGLREA 624
            |||||.|.:.|           |:..::   ::|.|.:|.|.|.:|.:.|::.:|.......:|.
  Fly   952 ADSSIMPVLVPCSHNSPEGILREQTQQL---LDRYAREGLRILVMAKRTLNSADYTDWWARHQEI 1013

Zfish   625 RLALQDREEKLMAMYNQVETGMSLIGATAVEDRLQEEAAETMEALQGAGMKIWVLTGDKMETAKS 689
            .::|::||.:|...:.::|:.::|:|||.:|||||:...||:.:|..||:.:|||||||.|||.:
  Fly  1014 EMSLENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAIN 1078

Zfish   690 TCYACRLFQRGTELLELTVRTLEDGRSKREDRLLELLRDYHRRAVQDAPPVKTGVVTRSWSANQE 754
            ..|:.:||.:..||:.||.|:.:...:.....|.::..|            ||       ::...
  Fly  1079 IAYSAKLFTQQMELIRLTARSRDAAETAINFYLTDMEND------------KT-------TSTLG 1124

Zfish   755 YG---------FIIDGATLSLVMNP------PRDADASLYRGLFLQICQNCTAVLCCRMAPLQKA 804
            ||         .::||.||:.:::|      |           ||::.:.|.:|||||..|||||
  Fly  1125 YGQSLRKKQRALVVDGKTLTFILDPKSKLILP-----------FLRLSKRCASVLCCRSTPLQKA 1178

Zfish   805 QIVKMVK---NCKGSPITLSIGDGANDVSMILEAHVGIGIKGKEGRQAVRNSDYAIPKLKHLKKL 866
            .:||:||   |.:    ||:|||||||||||..|.||:||.|:||.|||..:|:.:|:.::|::|
  Fly  1179 YLVKVVKEELNLR----TLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLERL 1239

Zfish   867 LLAHGHLYYVRIAHLVQYFFYKNLCFILPQFLYQFFCGYSQQPLYDAAYLTMYNICFTSMPILAY 931
            |||||:..|.|::.::.||||||..|:...|.||.:||:|.|.:.|..||.:||:.|||:|.||.
  Fly  1240 LLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAI 1304

Zfish   932 SLLEQHIAIEILLDNATLYREIAKNAML--RWRPFLYWTVL--GIFQGLLFFFGVRFLFSNPALQ 992
            .:.::.:|.::||.|..||    ||..|  .:||..:|.:|  .::|.|:.||.....::...: 
  Fly  1305 GVYDKRVAEDLLLKNPYLY----KNGRLGVAYRPHDFWLILLDALYQSLVIFFVALCAYAESDV- 1364

Zfish   993 DNGQVFGNWSYGTIVFTVLVFTVTLKLALDTRHWTWINHFVIWGSLAFYVFFSFFWGGIIWPFLK 1057
                  |.|.:||.:....:|...:..|::.|.||.::...|..||..:..|:..:..:......
  Fly  1365 ------GIWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFG 1423

Zfish  1058 QQRLYFVFANMLSSVSAWLVIIILILLSLLPEILLAVLR 1096
            .:..|:|.....:|...||||::..::::||.:||..:|
  Fly  1424 VRSSYWVIFVCFASAVHWLVIMLSTVVAVLPRLLLTTVR 1462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
atp11cXP_009289452.1 PhoLip_ATPase_N 31..90 CDD:292826 24/70 (34%)
ATPase-Plipid 40..1075 CDD:273734 364/1267 (29%)
Cation_ATPase 466..578 CDD:289987 46/267 (17%)
HAD_like <819..850 CDD:304363 23/31 (74%)
PhoLip_ATPase_C 850..1075 CDD:292829 70/229 (31%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 21/50 (42%)
ATPase-Plipid 250..1473 CDD:273734 373/1290 (29%)
E1-E2_ATPase 302..>394 CDD:278548 33/92 (36%)
Cation_ATPase <880..965 CDD:289987 34/85 (40%)
HAD_like <1177..1240 CDD:304363 35/67 (52%)
PhoLip_ATPase_C 1223..1468 CDD:292829 79/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.