DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wcd and UTP18

Sequence 1:NP_611121.1 Gene:wcd FlyBaseID:FBgn0262560 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_012466.1 Gene:UTP18 SGDID:S000003605 Length:594 Species:Saccharomyces cerevisiae

Alignment Length:617 Identity:143/618 (23%)
Similarity:223/618 (36%) Gaps:184/618 (30%)


  Fly    37 IPKASQAKELNYVEVPMEKVLFGDRQRLLTNLAK------------------SVGQKLPNDDEDE 83
            :|...:.::|      :.|.:|||...|..||||                  ..|.:..|.:|||
Yeast    12 VPPPDEEEQL------LAKFVFGDTTDLQENLAKFNADFIFNEQEMDVEDQEDEGSESDNSEEDE 70

  Fly    84 -------------------------------------QEENPGQAKPGDKRKAAWSDSDDEDLQV 111
                                                 ::::.......|..:|||.|||||.::|
Yeast    71 AQNGELDHVNNDQLFFVDDGGNEDSQDKNEDTMDVDDEDDSSSDDYSEDSEEAAWIDSDDEKIKV 135

  Fly   112 GDVKKATKHTGPLNHLRKDK----SYKE----------YLTARFQRTLNQPKWAEKKVKNEDDED 162
                       |:....|.|    ||.|          .|.::|::...:|||.:.:..:|.|::
Yeast   136 -----------PILVTNKTKKLRTSYNESKINGVHYINRLRSQFEKIYPRPKWVDDESDSELDDE 189

  Fly   163 VSSDEE----------------LLRTVGFIDRKARNSDLPQKTLNFKRVKDLNRATYAEGNATSI 211
            ...:||                |..|..:.|..:.:..||.|.|:..|:||.|.:..:.....|:
Yeast   190 EDDEEEGSNNVINGDINALTKILSTTYNYKDTLSNSKLLPPKKLDIVRLKDANASHPSHSAIQSL 254

  Fly   212 QFHPTSTAALVAGMNGLATIYAVDGQKNERLHNMRFKKFPLACSRIAPCGTRAFFGSVKPFYYSY 276
            .|||:....|..|.:....||.:||:.|..:.::.     |..|.|..|          .||.| 
Yeast   255 SFHPSKPLLLTGGYDKTLRIYHIDGKTNHLVTSLH-----LVGSPIQTC----------TFYTS- 303

  Fly   277 DLLEAKESKLKLPGAMEFMHRFEVS----------PCGKFIVTAG---------KFGAIHLLTAK 322
             |....:..:...|...:||.:::|          ...||....|         .|...||..::
Yeast   304 -LSNQNQQNIFTAGRRRYMHSWDLSLENLTHSQTAKIEKFSRLYGHESTQRSFENFKVAHLQNSQ 367

  Fly   323 TN---------------ELLHS--------FKQEGKVKGF-----TWSSDSKRILVCGSTSNVSV 359
            ||               .:|||        .|.||.:..|     ..|....|.::....:...|
Yeast   368 TNSVHGIVLLQGNNGWINILHSTSGLWLMGCKIEGVITDFCIDYQPISRGKFRTILIAVNAYGEV 432

  Fly   360 LNLRQNLIEHI---FMDDGCIHGESIQLS---------------PNQRLLATGSQEGVVNIYDYE 406
            .....|...|:   :.|.|.:....||:.               ...|.||.||:.|.||:||..
Yeast   433 WEFDLNKNGHVIRRWKDQGGVGITKIQVGGGTTTTCPALQISKIKQNRWLAVGSESGFVNLYDRN 497

  Fly   407 SIFASKAPQPEKRFMNLRTAITDLQFNHSSELLAMCSSEAPNAFKLAHFPSATVYSNFPAQNEKV 471
            :...|..|.|......|.|.|::|||:...::|.|.|....:|.:|.|.||.:|:||:|.....:
Yeast   498 NAMTSSTPTPVAALDQLTTTISNLQFSPDGQILCMASRAVKDALRLVHLPSCSVFSNWPTSGTPL 562

  Fly   472 GFVTSMAFSPHSSFLAFATKGKQVPLFRLKYF 503
            |.|||:||||....||...:..:|.|::|.::
Yeast   563 GKVTSVAFSPSGGLLAVGNEQGKVRLWKLNHY 594

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wcdNP_611121.1 WD40 <131..444 CDD:225201 93/408 (23%)
WD40 repeat 209..247 CDD:293791 11/38 (29%)
WD40 296..>504 CDD:295369 70/274 (26%)
WD40 repeat 298..332 CDD:293791 13/76 (17%)
WD40 repeat 337..371 CDD:293791 6/42 (14%)
WD40 repeat 376..415 CDD:293791 14/54 (26%)
WD40 repeat 428..465 CDD:293791 14/37 (38%)
UTP18NP_012466.1 Merozoite_SPAM 35..169 CDD:284533 27/145 (19%)
WD40 249..591 CDD:330360 90/359 (25%)
WD40 repeat 251..287 CDD:293791 11/36 (31%)
WD40 repeat 296..347 CDD:293791 11/63 (17%)
WD40 repeat 350..401 CDD:293791 9/51 (18%)
WD40 repeat 409..448 CDD:293791 5/39 (13%)
WD40 repeat 473..512 CDD:293791 13/39 (33%)
WD40 repeat 519..556 CDD:293791 14/37 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C936037
eggNOG 1 0.900 E1_KOG2055
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I1181
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004498
OrthoInspector 1 1.000 T1136188
orthoMCL 1 0.900 OOG5_129082
Panther 1 1.100 LDO PTHR18359
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1617
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.