DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wcd and AT5G14050

Sequence 1:NP_611121.1 Gene:wcd FlyBaseID:FBgn0262560 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_196909.1 Gene:AT5G14050 AraportID:AT5G14050 Length:546 Species:Arabidopsis thaliana

Alignment Length:542 Identity:152/543 (28%)
Similarity:262/543 (48%) Gaps:51/543 (9%)


  Fly     7 SDGLEELQSLKALYGQQEQEKP-------AKIKRERYIPKASQAKELNYVEV-PMEKVLFGDRQR 63
            |.|::. :.||..|...|.|:.       .:.||.:...:..:.:|...||: .:|.::||....
plant    10 SKGIKR-EELKKQYEDVEDEEEIGSDDDLTRGKRRKTEKEKQKLEESELVEMKKLENLIFGSLYS 73

  Fly    64 LLT-------------NLAKSVGQKLP------NDDEDEQEENPGQAKPGDKRKAAWSDSDDEDL 109
            .:|             ::.:|..:::|      :|||:..:|..||.....|.:|||.|.:::.:
plant    74 PVTFGKEEEEDGSALFHVDRSAVRQIPDYEDDGDDDEELSDEENGQVVAIRKGEAAWEDEEEKQI 138

  Fly   110 QVGDVKKATKHTGPLNHLRKDK-----SYKEY---LTARFQRTLNQPKWA--EKKV---KNEDDE 161
            .| |:....:    |..|||::     |..||   |.|...:......||  :.::   ::.||:
plant   139 NV-DIASVNR----LRKLRKEENEGLISGSEYIARLRAHHAKLNPGTDWARPDSQIVDGESSDDD 198

  Fly   162 DVSSD--EELLRTVGFIDRKARNSDLPQKTLNFKRVKDLNRATYAEGNATSIQFHPTSTAALVAG 224
            |....  :::|||...:..|:|.:.|....|.:.::.|.|.|..:.|...|:.||..:...|.||
plant   199 DTQDGGVDDILRTNEDLVVKSRGNKLCAGRLEYSKLVDANAADPSNGPINSVHFHQNAQLLLTAG 263

  Fly   225 MNGLATIYAVDGQKNERLHNMRFKKFPLACSRIAPCGTRAFFGSVKPFYYSYDLLEAKESKL-KL 288
            ::.....:.:||::|.::.::..:..|:..:...|.|::......:.|:||:||.:||..|: .|
plant   264 LDRRLRFFQIDGKRNTKIQSIFLEDCPIRKAAFLPNGSQVIVSGRRKFFYSFDLEKAKFDKIGPL 328

  Fly   289 PGAME-FMHRFEVSPCGKFIVTAGKFGAIHLLTAKTNELLHSFKQEGKVKGFTWSSDSKRILVCG 352
            .|..| .:..||||.....|...|..|.|.|::.||.||:.:.|..|.|:...:|.|.|.:|..|
plant   329 VGREEKSLEYFEVSQDSNTIAFVGNEGYILLVSTKTKELIGTLKMNGSVRSLAFSEDGKHLLSSG 393

  Fly   353 STSNVSVLNLRQNLIEHIFMDDGCIHGESIQLSPNQRLLATGSQEGVVNIYDYESIFASKAPQPE 417
            ....|.|.:||.....:..:|:|...|.|:..|.|..|.|:|:..|:||||. :|.|.....:|.
plant   394 GDGQVYVWDLRTMKCLYKGVDEGSTCGTSLCSSLNGALFASGTDRGIVNIYK-KSEFVGGKRKPI 457

  Fly   418 KRFMNLRTAITDLQFNHSSELLAMCSSEAPNAFKLAHFPSATVYSNFPAQNEKVGFVTSMAFSPH 482
            |...||.:.|..::|||.:::||:.|:...|:.||.|.||.||:||:|..|..:.:...:.|||.
plant   458 KTVDNLTSKIDFMKFNHDAQILAIVSTMNKNSVKLVHVPSLTVFSNWPPPNSTMHYPRCLDFSPG 522

  Fly   483 SSFLAFATKGKQVPLFRLKYFK 504
            |.|:|......:|.|::|.:::
plant   523 SGFMAMGNAAGKVLLYKLHHYQ 544

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wcdNP_611121.1 WD40 <131..444 CDD:225201 96/330 (29%)
WD40 repeat 209..247 CDD:293791 9/38 (24%)
WD40 296..>504 CDD:295369 73/208 (35%)
WD40 repeat 298..332 CDD:293791 14/34 (41%)
WD40 repeat 337..371 CDD:293791 9/34 (26%)
WD40 repeat 376..415 CDD:293791 14/39 (36%)
WD40 repeat 428..465 CDD:293791 16/37 (43%)
AT5G14050NP_196909.1 GEMIN8 <15..63 CDD:291993 10/49 (20%)
WD40 241..543 CDD:225201 97/303 (32%)
WD40 245..484 CDD:295369 76/240 (32%)
WD40 repeat 247..286 CDD:293791 9/39 (23%)
WD40 repeat 292..330 CDD:293791 11/38 (29%)
WD40 repeat 334..371 CDD:293791 13/37 (35%)
WD40 repeat 378..414 CDD:293791 9/36 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H41087
Inparanoid 1 1.050 194 1.000 Inparanoid score I1315
OMA 1 1.010
OrthoDB 1 1.010 D462558at2759
OrthoInspector 1 1.000 T192379
orthoMCL 1 0.900 OOG5_129082
Panther 1 1.100 LDO PTHR18359
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.