DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wcd and utp18

Sequence 1:NP_611121.1 Gene:wcd FlyBaseID:FBgn0262560 Length:506 Species:Drosophila melanogaster
Sequence 2:XP_012827232.1 Gene:utp18 XenbaseID:XB-GENE-981919 Length:522 Species:Xenopus tropicalis

Alignment Length:510 Identity:148/511 (29%)
Similarity:263/511 (51%) Gaps:39/511 (8%)


  Fly    22 QQEQEKPAKIKRERYIPKASQAKELNYVEVPMEKVLFGDRQRLLTNL---AKS----VGQKLPND 79
            |::..|..:..|.:::...:...|.:.:   :|:.:||.....:..|   :|:    .|..|.:|
 Frog    27 QEQNMKEEEELRTKHLKALADKPETDTI---LEEFVFGGEDEFVEKLIGHSKARHTVSGDLLESD 88

  Fly    80 DEDEQEENPGQAKPGDKRKAAWSDSDD---EDLQV-----GDVKKATKHTGPLNHLRKDKSYKEY 136
            .|:|..||....    .||.||.|.:|   |::::     .|:.|:...|.    |.|:| .:..
 Frog    89 SEEETSENAAPL----ARKPAWVDEEDEHEENIEMTHRYRKDIMKSKTETA----LSKEK-LQAR 144

  Fly   137 LTARFQRTL-NQPKWA----EKKVKNEDDE-DVSSDEELLRTVGFIDRKARNSDLPQKTLNFKRV 195
            |..:||:.: ..|.||    :|::..||:| :..:|:.||...|  :..:::|.|.:..:..::.
 Frog   145 LQEQFQKAMGGVPSWACQGSKKRISKEDEESEEENDDNLLSKTG--NLLSQSSYLSKGVIQIRKC 207

  Fly   196 KDLNRATYAEGNATSIQFHPTSTAALVAGMNGLATIYAVDGQKNERLHNMRFKKFPLACSRIAPC 260
            .:.|....:....|::||||.:...:.||.:...:::.|||::|:::.::..:|||:..::.:..
 Frog   208 INANHERLSRVPLTTVQFHPLAQVVMTAGFDRSVSLFQVDGKRNQKIQSIHLEKFPIYKAQFSAD 272

  Fly   261 GTRAF-FGSVKPFYYSYDLLEAKESKL-KLPGAME-FMHRFEVSPCGKFIVTAGKFGAIHLLTAK 322
            |.:.. .|.....:|.||::......: ::.|..| .:.:|||||.|.|::..|..|.:|||:.|
 Frog   273 GEQVIATGLRSKMFYIYDMMGGNIITVPRIRGLEERVIQQFEVSPNGSFLLLNGSAGYLHLLSMK 337

  Fly   323 TNELLHSFKQEGKVKGFTWSSDSKRILVCGSTSNVSVLNLRQNLIEHIFMDDGCIHGESIQLSPN 387
            |.||:.|.|..||.....:|.||.::........|.|.::|.....:.|.|:|.|.|.||.||.:
 Frog   338 TKELIGSMKMNGKSMKAVFSPDSSKVFSNSDDGFVYVWDVRSRQCLNKFTDEGSICGTSIALSRD 402

  Fly   388 QRLLATGSQEGVVNIYDYESIFASKAPQPEKRFMNLRTAITDLQFNHSSELLAMCSSEAPNAFKL 452
            .|.::.||..||||||::|.......|:|.|..|||.|:.:.:.||..:|::|:.|::..:|.||
 Frog   403 GRYISCGSNSGVVNIYNHEDCLQQTNPRPLKAIMNLVTSASSIIFNPQTEIMAVASNKTDDAVKL 467

  Fly   453 AHFPSATVYSNFPAQNEK-VGFVTSMAFSPHSSFLAFATKGKQVPLFRLKYFKGY 506
            .|.||.:|:||||.||:| :....:|.|||.|.:.:.|....:..|:|||::..:
 Frog   468 VHIPSFSVFSNFPGQNKKSIHLPRAMDFSPRSGYFSIANNKGEALLYRLKHYSDF 522

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wcdNP_611121.1 WD40 <131..444 CDD:225201 96/322 (30%)
WD40 repeat 209..247 CDD:293791 11/38 (29%)
WD40 296..>504 CDD:295369 81/209 (39%)
WD40 repeat 298..332 CDD:293791 18/34 (53%)
WD40 repeat 337..371 CDD:293791 6/34 (18%)
WD40 repeat 376..415 CDD:293791 17/39 (44%)
WD40 repeat 428..465 CDD:293791 15/37 (41%)
utp18XP_012827232.1 WD40 197..520 CDD:225201 104/323 (32%)
WD40 214..458 CDD:295369 77/244 (32%)
WD40 repeat 220..260 CDD:293791 11/40 (28%)
WD40 repeat 265..304 CDD:293791 5/39 (13%)
WD40 repeat 309..345 CDD:293791 17/36 (47%)
WD40 repeat 352..387 CDD:293791 7/35 (20%)
WD40 repeat 394..436 CDD:293791 18/42 (43%)
WD40 repeat 442..480 CDD:293791 15/38 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2055
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H41087
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D462558at2759
OrthoFinder 1 1.000 FOG0004498
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.790

Return to query results.
Submit another query.