DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wcd and UTP18

Sequence 1:NP_611121.1 Gene:wcd FlyBaseID:FBgn0262560 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_057085.2 Gene:UTP18 HGNCID:24274 Length:556 Species:Homo sapiens

Alignment Length:510 Identity:158/511 (31%)
Similarity:251/511 (49%) Gaps:61/511 (12%)


  Fly    24 EQEKPAKIKRERYIPKASQAKELNYVEVPMEKVLFG----DRQRLLTNLAKSVGQKLP--NDDED 82
            |::|||                   ||..:|:::||    |...||..|.   |.::.  .|..|
Human    81 EEDKPA-------------------VERCLEELVFGDVENDEDALLRRLR---GPRVQEHEDSGD 123

  Fly    83 EQEENPGQAKPGDKRKAAWSDSDDEDLQVGDVKKATKHTGPLNHLRKD------------KSYKE 135
            .:.||..:.....::|..|.|.:|||.::.|:..        |..|||            .:.|:
Human   124 SEVENEAKGNFPPQKKPVWVDEEDEDEEMVDMMN--------NRFRKDMMKNASESKLSKDNLKK 180

  Fly   136 YLTARFQRTL-NQPKWAE---KKVKNEDDEDVSSDEELLRTVGFIDRKARNSDLPQKTLNFKRVK 196
            .|...||..: ..|.|||   :|..::|:.:...|:.|.||..||   :.::.||:..|..|..:
Human   181 RLKEEFQHAMGGVPAWAETTKRKTSSDDESEEDEDDLLQRTGNFI---STSTSLPRGILKMKNCQ 242

  Fly   197 DLNRATYAEGNATSIQFHPTSTAALVAGMNGLATIYAVDGQKNERLHNMRFKKFPLACSRIAPCG 261
            ..|.........:|:||||.:...:|||::...:::.|||:.|.::.::..::||:..:..:..|
Human   243 HANAERPTVARISSVQFHPGAQIVMVAGLDNAVSLFQVDGKTNPKIQSIYLERFPIFKACFSANG 307

  Fly   262 TRAFFGSV-KPFYYSYDLLEAKESKL-KLPGAME-FMHRFEVSPCGKFIVTAGKFGAIHLLTAKT 323
            ......|. ....|.||:|..|...: ::.|..| .:..|||||.|.|::..|..|.:|||..||
Human   308 EEVLATSTHSKVLYVYDMLAGKLIPVHQVRGLKEKIVRSFEVSPDGSFLLINGIAGYLHLLAMKT 372

  Fly   324 NELLHSFKQEGKVKGFTWSSDSKRILVCGSTSNVSVLNLRQNLIEHIFMDDGCIHGESIQLSPNQ 388
            .||:.|.|..|:|...|:|||||::........|.|.::......:.|:|:|.::|.||..|.|.
Human   373 KELIGSMKINGRVAASTFSSDSKKVYASSGDGEVYVWDVNSRKCLNRFVDEGSLYGLSIATSRNG 437

  Fly   389 RLLATGSQEGVVNIYDYESIFASKAPQPEKRFMNLRTAITDLQFNHSSELLAMCSSEAPNAFKLA 453
            :.:|.||..||||||:.:|......|:|.|..|||.|.:|.|.||.::|:||:.|.:...|.:|.
Human   438 QYVACGSNCGVVNIYNQDSCLQETNPKPIKAIMNLVTGVTSLTFNPTTEILAIASEKMKEAVRLV 502

  Fly   454 HFPSATVYSNFPA-QNEKVGFVTSMAFSPHSSFLAFAT-KGKQVPLFRLKYFKGY 506
            |.||.||:||||. :|:.:..|.:|.|||.|.:.|... |||.: ::||.::..:
Human   503 HLPSCTVFSNFPVIKNKNISHVHTMDFSPRSGYFALGNEKGKAL-MYRLHHYSDF 556

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wcdNP_611121.1 WD40 <131..444 CDD:225201 105/320 (33%)
WD40 repeat 209..247 CDD:293791 12/38 (32%)
WD40 296..>504 CDD:295369 85/210 (40%)
WD40 repeat 298..332 CDD:293791 18/34 (53%)
WD40 repeat 337..371 CDD:293791 8/34 (24%)
WD40 repeat 376..415 CDD:293791 16/39 (41%)
WD40 repeat 428..465 CDD:293791 18/37 (49%)
UTP18NP_057085.2 WD40 230..493 CDD:295369 89/263 (34%)
WD 1 249..288 12/39 (31%)
WD40 repeat 254..294 CDD:293791 12/40 (30%)
WD40 <270..554 CDD:225201 101/285 (35%)
WD 2 293..333 9/40 (23%)
WD40 repeat 299..338 CDD:293791 7/39 (18%)
WD 3 339..380 18/41 (44%)
WD40 repeat 344..380 CDD:293791 17/36 (47%)
WD 4 381..419 10/38 (26%)
WD40 repeat 388..421 CDD:293791 9/33 (27%)
WD 5 421..462 17/41 (41%)
WD40 repeat 428..470 CDD:293791 18/42 (43%)
WD 6 471..512 19/41 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2055
Hieranoid 1 1.000
Homologene 1 1.000 H41087
Inparanoid 1 1.050 229 1.000 Inparanoid score I3408
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D462558at2759
OrthoFinder 1 1.000 FOG0004498
OrthoInspector 1 1.000 T1073660
orthoMCL 1 0.900 OOG5_129082
Panther 1 1.100 LDO PTHR18359
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1617
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.