DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wcd and Utp18

Sequence 1:NP_611121.1 Gene:wcd FlyBaseID:FBgn0262560 Length:506 Species:Drosophila melanogaster
Sequence 2:XP_017452802.1 Gene:Utp18 RGDID:1309957 Length:639 Species:Rattus norvegicus

Alignment Length:505 Identity:160/506 (32%)
Similarity:249/506 (49%) Gaps:51/506 (10%)


  Fly    24 EQEKPAKIKRERYIPKASQAKELNYVEVPMEKVLFG----DRQRLLTNLAKSVGQKLPNDD---- 80
            |.:|||                   .|..:|:::||    |...||..|..|.|....:.|    
  Rat   164 ENDKPA-------------------AERCLEQLVFGDVEDDEDALLRRLRSSRGHLHGSSDDSEV 209

  Fly    81 EDEQEENPGQAKPGDKRKAAWSDSDDEDLQVGDV-----KKATKHTGPLNHLRKDKSYKEYLTAR 140
            |||..:|..|.||      .|.|.||||.::.|:     :|........:.|.|||..|. |...
  Rat   210 EDEAVDNLSQKKP------VWVDEDDEDEEIVDMMNNRFRKDMMKNASESKLSKDKLQKR-LKEE 267

  Fly   141 FQRTL-NQPKWAE----KKVKNEDDEDVSSDEELLRTVGFIDRKARNSDLPQKTLNFKRVKDLNR 200
            ||..: ..|.|||    :|..::|:.:...|:.|.||..||   :.::.||:..|..|..:..|.
  Rat   268 FQHAMGGVPDWAEPGSKRKTSSDDESEEDEDDLLQRTGNFI---STSTSLPRGILKMKNCRPANA 329

  Fly   201 ATYAEGNATSIQFHPTSTAALVAGMNGLATIYAVDGQKNERLHNMRFKKFPLACSRIAPCGTRAF 265
            ........:|:||||.:...:|:|::...:::.|||:.|.::.::..:|||:..:..:..|....
  Rat   330 ERPTTARISSVQFHPGAQVVMVSGVDHAISLFQVDGKTNPKIQSIYLEKFPIFKACFSANGEEVL 394

  Fly   266 FGSV-KPFYYSYDLLEAKESKL-KLPGAME-FMHRFEVSPCGKFIVTAGKFGAIHLLTAKTNELL 327
            ..|: ....|.||::..|...: ::.|..| .:.||||||.|.|::.:|..|..|||:.||.||:
  Rat   395 ATSMHSKVIYVYDMIAGKLIPVHQVRGLKEKIVKRFEVSPDGSFLLISGIAGFSHLLSMKTKELI 459

  Fly   328 HSFKQEGKVKGFTWSSDSKRILVCGSTSNVSVLNLRQNLIEHIFMDDGCIHGESIQLSPNQRLLA 392
            .|.|..|::...|:|||||||........|.|.::......:.|:|:|.::|.||..|.|.:.:|
  Rat   460 GSMKINGRISASTFSSDSKRIYTSSGNGEVYVWDVNSRKCINRFLDEGSLYGLSIAASKNGQYVA 524

  Fly   393 TGSQEGVVNIYDYESIFASKAPQPEKRFMNLRTAITDLQFNHSSELLAMCSSEAPNAFKLAHFPS 457
            .||:.||||||:.:|......|:|.|..|||.|.:|.|.||.::|:||:.|.:...|.:|.|.||
  Rat   525 CGSKSGVVNIYNQDSCLQQTNPKPIKAIMNLVTGVTSLAFNPTTEILAVASRKMKEAVRLVHLPS 589

  Fly   458 ATVYSNFPA-QNEKVGFVTSMAFSPHSSFLAFATKGKQVPLFRLKYFKGY 506
            .||:||||. :...:..|.:|.|||...:.|...:..:..|:||.::..:
  Rat   590 CTVFSNFPVYKKSTLSRVQTMDFSPRGGYFALGNEQGKALLYRLHHYSDF 639

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wcdNP_611121.1 WD40 <131..444 CDD:225201 107/321 (33%)
WD40 repeat 209..247 CDD:293791 11/38 (29%)
WD40 296..>504 CDD:295369 83/209 (40%)
WD40 repeat 298..332 CDD:293791 18/34 (53%)
WD40 repeat 337..371 CDD:293791 10/34 (29%)
WD40 repeat 376..415 CDD:293791 16/39 (41%)
WD40 repeat 428..465 CDD:293791 18/37 (49%)
Utp18XP_017452802.1 HDV_ag <114..>193 CDD:279813 11/48 (23%)
WD40 <304..634 CDD:225201 113/333 (34%)
WD40 337..575 CDD:295369 84/238 (35%)
WD40 repeat 337..377 CDD:293791 11/40 (28%)
WD40 repeat 382..421 CDD:293791 6/39 (15%)
WD40 repeat 427..463 CDD:293791 18/36 (50%)
WD40 repeat 469..504 CDD:293791 11/35 (31%)
WD40 repeat 511..553 CDD:293791 18/42 (43%)
WD40 repeat 559..594 CDD:293791 15/35 (43%)
WD40 repeat 607..631 CDD:293791 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2055
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H41087
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D462558at2759
OrthoFinder 1 1.000 FOG0004498
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129082
Panther 1 1.100 LDO PTHR18359
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
87.880

Return to query results.
Submit another query.