DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wcd and Utp18

Sequence 1:NP_611121.1 Gene:wcd FlyBaseID:FBgn0262560 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001013393.1 Gene:Utp18 MGIID:1923402 Length:552 Species:Mus musculus

Alignment Length:501 Identity:159/502 (32%)
Similarity:248/502 (49%) Gaps:41/502 (8%)


  Fly    24 EQEKPAKIKRERYIPKASQAKELNYVEVPMEKVLFG----DRQRLLTNLAKSVGQKLPNDDEDEQ 84
            |.:|||                   .|..:|:::||    |...||..|..|.||...:.||.|.
Mouse    75 EDDKPA-------------------AERCLEQLVFGDVEDDEDALLQRLRSSRGQLHGSSDESEV 120

  Fly    85 EENPGQAKPGDKRKAAWSDSDDEDLQVGDV-----KKATKHTGPLNHLRKDKSYKEYLTARFQRT 144
            |..........|::..|.|.||||.::.|:     :|........:.|.|||..|. |...||..
Mouse   121 ENEAKDIFSQKKKQPVWVDEDDEDEEIVDMSNNRFRKDIMKNASESKLSKDKLQKR-LKEEFQHA 184

  Fly   145 L-NQPKWAE---KKVKNEDDEDVSSDEELL-RTVGFIDRKARNSDLPQKTLNFKRVKDLNRATYA 204
            : ..|.|||   |:..:.|||....:::|| ||..||   :.::.||:..|..|..:..|.....
Mouse   185 MGGVPDWAEAGSKRRTSSDDESEEDEDDLLQRTGNFI---STSTSLPRGILKMKNCRPANAERPT 246

  Fly   205 EGNATSIQFHPTSTAALVAGMNGLATIYAVDGQKNERLHNMRFKKFPLACSRIAPCGTRAFFGSV 269
            ....:|:||||.:...:|:|::...:::.|||:.|.::.::..:|||:..:..:..|......|:
Mouse   247 TARISSVQFHPGAQVVMVSGVDNAISLFQVDGKTNPKIQSIYLEKFPIFKACFSANGEEVLATSM 311

  Fly   270 -KPFYYSYDLLEAKESKL-KLPGAME-FMHRFEVSPCGKFIVTAGKFGAIHLLTAKTNELLHSFK 331
             ....|.||:|..|...: ::.|..| .:.:|||||.|.|::.:|..|..|||:.||.||:.|.|
Mouse   312 HSKVLYVYDMLAGKLIPVHQVRGLKEKTVKQFEVSPDGSFLLISGIAGFSHLLSMKTKELIGSMK 376

  Fly   332 QEGKVKGFTWSSDSKRILVCGSTSNVSVLNLRQNLIEHIFMDDGCIHGESIQLSPNQRLLATGSQ 396
            ..|::...|:|||||||........|.|.::......:.|:|:|.:.|.||..|.|.:.:|.||:
Mouse   377 INGRIAASTFSSDSKRIYTYSENGEVYVWDVNSRKCMNRFLDEGSLCGLSIAASKNGQYVACGSK 441

  Fly   397 EGVVNIYDYESIFASKAPQPEKRFMNLRTAITDLQFNHSSELLAMCSSEAPNAFKLAHFPSATVY 461
            .||||||:.:|......|:|.|..|||.|.:|.|.||.::|:||:.|.:...|.:|.|.||.||:
Mouse   442 SGVVNIYNQDSCLQQTNPKPIKAIMNLVTGVTSLAFNPTTEILAVASRKMKEAVRLVHLPSCTVF 506

  Fly   462 SNFPA-QNEKVGFVTSMAFSPHSSFLAFATKGKQVPLFRLKYFKGY 506
            ||||. :...:..|.:|.|||...:.|...:..:..::||.::..:
Mouse   507 SNFPVFKKSTLSRVQTMDFSPRGGYFALGNEKGRALMYRLHHYSDF 552

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wcdNP_611121.1 WD40 <131..444 CDD:225201 109/321 (34%)
WD40 repeat 209..247 CDD:293791 11/38 (29%)
WD40 296..>504 CDD:295369 81/209 (39%)
WD40 repeat 298..332 CDD:293791 18/34 (53%)
WD40 repeat 337..371 CDD:293791 10/34 (29%)
WD40 repeat 376..415 CDD:293791 16/39 (41%)
WD40 repeat 428..465 CDD:293791 18/37 (49%)
Utp18NP_001013393.1 WD40 <217..547 CDD:225201 112/333 (34%)
WD 1 245..284 11/39 (28%)
WD40 250..488 CDD:295369 84/238 (35%)
WD40 repeat 250..290 CDD:293791 11/40 (28%)
WD 2 289..329 10/40 (25%)
WD40 repeat 295..334 CDD:293791 7/39 (18%)
WD40 repeat 340..376 CDD:293791 17/36 (47%)
WD 3 376..415 12/39 (31%)
WD40 repeat 384..418 CDD:293791 11/34 (32%)
WD 4 417..458 17/41 (41%)
WD40 repeat 425..466 CDD:293791 17/41 (41%)
WD 5 467..508 19/41 (46%)
WD 6 515..551 8/36 (22%)
WD40 repeat 520..541 CDD:293791 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2055
Hieranoid 1 1.000
Homologene 1 1.000 H41087
Inparanoid 1 1.050 233 1.000 Inparanoid score I3390
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004498
OrthoInspector 1 1.000 T1083745
orthoMCL 1 0.900 OOG5_129082
Panther 1 1.100 LDO PTHR18359
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1617
TreeFam 1 0.960
1211.860

Return to query results.
Submit another query.