DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wcd and B0280.9

Sequence 1:NP_611121.1 Gene:wcd FlyBaseID:FBgn0262560 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_498555.1 Gene:B0280.9 WormBaseID:WBGene00015104 Length:429 Species:Caenorhabditis elegans

Alignment Length:437 Identity:126/438 (29%)
Similarity:206/438 (47%) Gaps:40/438 (9%)


  Fly    95 DKRKAAWSDSDDEDLQVGDVKKA-------TKHTGPLNHLRKDKSYKEYLTARFQRTLNQ----- 147
            :..|.||.|.||:::.|...||.       .|.|....|...|.  |||: .|.|....:     
 Worm     8 ESEKPAWHDEDDDNMVVAVPKKVKMTMRVELKRTTDEEHGELDS--KEYV-GRLQEAFRKRHGGT 69

  Fly   148 PKWAEKKVKNEDDEDVSSDEELLRT-VGFIDRKARNSDLPQKTLNFKRVKDLNRA-TYAEGNATS 210
            ||||  |....|:|:.|    ||:| .|::   |::.:||:.|::...:||.|.. .|..| .|.
 Worm    70 PKWA--KAAAGDEEEGS----LLKTAAGYL---AKDVNLPKTTIHTTLIKDFNIGHRYTRG-ITV 124

  Fly   211 IQFHPTSTAALVAGMNGLATIYAV--DGQKNERLHNMRFKKFPLACSRIAPCGTRAFFGSVKPFY 273
            ::||.|....:||...|...::.|  :.:|:..|.:..|.|||:....||..|......|.:..|
 Worm   125 VKFHKTRPVLIVADQGGNVQLFKVSREVKKDRFLQSANFSKFPIDSLEIADKGHSVICSSSRKEY 189

  Fly   274 YSYDLLEAKE-SKLKLPGAM--EFMHRFEVSPCGKFIVTAGKFGAIHLLTAKTNELLHSFK---Q 332
            .....:|.:| ::||.|..:  :.:..|.:|...:|:..||....|::|.|.:.|.:.:..   .
 Worm   190 LMQYNMETREVTQLKPPNTVPKQGIRLFAISHDSQFLAIAGHNSHIYVLHATSMEHITTISLPAN 254

  Fly   333 EGKVKGFTWSSDSKRILVCGSTSNVSVLNL---RQNLIEHIFMDDGCIHGESIQLSPNQRLLATG 394
            ..::|.|  .|.|:.|.:...|..:.:.|:   .....:|.|.|||.:||.::.:|.:....|||
 Worm   255 ASEIKFF--PSHSREIWIICETGQIVIANIGLPGTKSSQHTFTDDGAVHGTTLAISQHGDYFATG 317

  Fly   395 SQEGVVNIYDYESIFASKAPQPEKRFMNLRTAITDLQFNHSSELLAMCSSEAPNAFKLAHFPSAT 459
            |..|:||:|.......|..|:|.....||.||::.:.||..::|:|:||:...|..:|.|..|.|
 Worm   318 SDTGIVNVYSGNDCRNSTNPRPLFNVSNLVTAVSSIAFNSDAQLMAICSNVKDNHLRLVHVASQT 382

  Fly   460 VYSNFPAQNEKVGFVTSMAFSPHSSFLAFATKGKQVPLFRLKYFKGY 506
            .:.|||.:|.||.....:.|||:..::|......::.:|.:.:|..|
 Worm   383 TFKNFPERNGKVTHARCVEFSPNGGYMAVGNDDGRLHVFEIHHFTDY 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wcdNP_611121.1 WD40 <131..444 CDD:225201 95/331 (29%)
WD40 repeat 209..247 CDD:293791 10/40 (25%)
WD40 296..>504 CDD:295369 62/214 (29%)
WD40 repeat 298..332 CDD:293791 9/37 (24%)
WD40 repeat 337..371 CDD:293791 8/37 (22%)
WD40 repeat 376..415 CDD:293791 13/39 (33%)
WD40 repeat 428..465 CDD:293791 13/37 (35%)
B0280.9NP_498555.1 WD40 <66..424 CDD:225201 106/370 (29%)
WD40 repeat 122..195 CDD:293791 19/73 (26%)
WD40 167..423 CDD:295369 72/258 (28%)
WD40 repeat 168..207 CDD:293791 10/39 (26%)
WD40 repeat 201..251 CDD:293791 12/50 (24%)
WD40 repeat 258..296 CDD:293791 9/40 (23%)
WD40 repeat 303..343 CDD:293791 12/40 (30%)
WD40 repeat 350..388 CDD:293791 13/38 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C929487
eggNOG 1 0.900 E1_KOG2055
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I2827
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D462558at2759
OrthoFinder 1 1.000 FOG0004498
OrthoInspector 1 1.000 T476085
orthoMCL 1 0.900 OOG5_129082
Panther 1 1.100 LDO PTHR18359
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1617
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.