DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7755 and Idh3b

Sequence 1:NP_611110.2 Gene:CG7755 FlyBaseID:FBgn0034105 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_446033.1 Gene:Idh3b RGDID:621881 Length:385 Species:Rattus norvegicus

Alignment Length:361 Identity:83/362 (23%)
Similarity:165/362 (46%) Gaps:30/362 (8%)


  Fly    30 AAYAKGDARADPVNVLPKSKYGGINTVSLVTGTTIIGQQGAQFVSSLLSSSRVPV--------EV 86
            :|.|...::|..|.|      .|...|:::.|.. :|.:....|..:..::.|||        ||
  Rat    31 SAQAASQSQAQDVRV------EGAFPVTMLPGDG-VGPELMHAVKEVFKAAAVPVEFKEHHLSEV 88

  Fly    87 QVIEAGQD-DEYFHSVLRNRTA----VHVDNQADAEAKQKALKICNDLDLYVFKTRTRSFPGFKC 146
            |.:.:.:. ::...|:..|:.|    ::...:...|.....:::...|||:......:|.||:|.
  Rat    89 QNMASEEKLEQVLSSMKENKVAIIGKIYTPMEYKGELASYDMQLRRKLDLFANVVHVKSLPGYKT 153

  Fly   147 RFPGVDIQLIGQNNMGIFNELEYSPVEGVVEALSVVSQKGNDKYLRYAFKAAAKAGRKRVTLINK 211
            |...:|:.:|.:...|.::.||:....||:|.|.:|::..:.:..::||..|.|.||.:||.::|
  Rat   154 RHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRTKSQRIAKFAFDYATKKGRSKVTAVHK 218

  Fly   212 AKEWPISDGSLVEAAQRLHCHYKDCLELELMEVEEAISRLMTEPTYFDCLFASERYATFLSAICS 276
            |....:.||..::..:.:...|.. ::.|.|.::....:|:..|..||.|.....|...:..:.:
  Rat   219 ANIMKLGDGLFLQCCEEVAELYPK-IKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAA 282

  Fly   277 GVCGGANLFSAVEIGDHHAVFK-----PLQTKLSLTNYANLSAYGIVSTIVDLFQHLGHDKCADA 336
            |:.|||.:.........:|||:     |....:. .|.||.:|  ::.:..::.:||..:..:..
  Rat   283 GLVGGAGVVPGESYSAEYAVFETGARHPFAQAVG-RNIANPTA--MLLSASNMLRHLNLEYHSSM 344

  Fly   337 LWCELKRTMDEG-IRTKEFGGQDTGEYVICNIINQL 371
            :...:|:.:..| :||::.||..|....|.::|..|
  Rat   345 IADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHL 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7755NP_611110.2 Iso_dh 51..371 CDD:294303 77/339 (23%)
Idh3bNP_446033.1 Iso_dh 47..380 CDD:294303 77/338 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.