DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7755 and LEU2

Sequence 1:NP_611110.2 Gene:CG7755 FlyBaseID:FBgn0034105 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_009911.2 Gene:LEU2 SGDID:S000000523 Length:364 Species:Saccharomyces cerevisiae

Alignment Length:350 Identity:66/350 (19%)
Similarity:112/350 (32%) Gaps:120/350 (34%)


  Fly    77 LSSSRVPVEVQVIEAGQDDEYFHSVLRNRTAVHVDNQADAEAKQKALKICNDLDLYVFKTRTRSF 141
            :.::.||:..:.:||.:..:   :||................:|..|||..:|.||. ..|..:|
Yeast    51 IDATGVPLPDEALEASKKAD---AVLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYA-NLRPCNF 111

  Fly   142 PG--------FKCRF-PGVDI----QLIGQ-----------------------------NNMGIF 164
            ..        .|.:| .|.|.    :|:|.                             ..|..|
Yeast   112 ASDSLLDLSPIKPQFAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAF 176

  Fly   165 NELEYSPVEGVVEALSVVS-QKGNDKYLRYAFKAAAKAGRKRV--TLINKAKEWPISDGSLVEAA 226
            ..|::.|      .|.:.| .|.|       ..|:::..||.|  |:.|   |:|          
Yeast   177 MALQHEP------PLPIWSLDKAN-------VLASSRLWRKTVEETIKN---EFP---------- 215

  Fly   227 QRLHCHYKDCLELELMEVEEAISRLMTEPTYFD-CLFASERYATFLSAICSGVCGGANLF---SA 287
                     .|:::...::.|...|:..||:.: .:..|..:...:|...|.:.|...|.   |.
Yeast   216 ---------TLKVQHQLIDSAAMILVKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASL 271

  Fly   288 VEIGDHHAVF------------------KPLQTKLSLTNYANLSAYGIVSTIVDLFQHLGHDKCA 334
            ..:.|.:..|                  .|:.|.||......||              |...:..
Yeast   272 ASLPDKNTAFGLYEPCHGSAPDLPKNKVNPIATILSAAMMLKLS--------------LNLPEEG 322

  Fly   335 DALWCELKRTMDEGIRTKEFGGQDT 359
            .|:...:|:.:|.||||.:.||.::
Yeast   323 KAIEDAVKKVLDAGIRTGDLGGSNS 347

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7755NP_611110.2 Iso_dh 51..371 CDD:294303 66/350 (19%)
LEU2NP_009911.2 leuB 6..359 CDD:272939 66/350 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S361
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.