DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7755 and IDH1

Sequence 1:NP_611110.2 Gene:CG7755 FlyBaseID:FBgn0034105 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_195252.1 Gene:IDH1 AraportID:AT4G35260 Length:367 Species:Arabidopsis thaliana

Alignment Length:345 Identity:87/346 (25%)
Similarity:159/346 (46%) Gaps:19/346 (5%)


  Fly    42 VNVLPKSKYGGINTVSLVTGTTIIGQQGAQFVSSLLSSSRVPVEVQVIEAGQD-----DEYFHSV 101
            |..:|:...|....|:|:.|.. ||......|..::.:...|:..:..:...:     .|...|:
plant    26 VTYMPRPGDGAPRAVTLIPGDG-IGPLVTNAVEQVMEAMHAPIFFEKYDVHGEMSRVPPEVMESI 89

  Fly   102 LRNRTAVH--VDNQADAEAKQKALKICNDLDLYVFKTRTRSFPGFKCRFPGVDIQLIGQNNMGIF 164
            .:|:..:.  :............:::..:|||:.......:.||...|...|||.:|.:|..|.:
plant    90 RKNKVCLKGGLKTPVGGGVSSLNVQLRKELDLFASLVNCFNLPGLPTRHENVDIVVIRENTEGEY 154

  Fly   165 NELEYSPVEGVVEALSVVSQKGNDKYLRYAFKAAAKAGRKRVTLINKAKEWPISDGSLVEAAQRL 229
            ..||:..|.||||:|.|:::..:::..:|||:.|....||:||.::||....::||..:|:.:.:
plant   155 AGLEHEVVPGVVESLKVITKFCSERIAKYAFEYAYLNNRKKVTAVHKANIMKLADGLFLESCREV 219

  Fly   230 HCHYKDCLELELMEVEEAISRLMTEPTYFDCLFASERYATFLSAICSGVCGGANLFSAVEIGDHH 294
            ...|......|:: |:....:|:.:|..||.:.....|...::...:|:.||..:.....:|..|
plant   220 AKKYPSITYNEII-VDNCCMQLVAKPEQFDVMVTPNLYGNLVANTAAGIAGGTGVMPGGNVGADH 283

  Fly   295 AVFKP-------LQTKLSLTNYANLSAYGIVSTIVDLFQHLGHDKCADALWCELKRTMDEG-IRT 351
            |||:.       .:.|:.|.|.||..|..:.|.:  :.:||.....||.|...:|:.:.|| .||
plant   284 AVFEQGASAGNVGKDKIVLENKANPVALLLSSAM--MLRHLQFPSFADRLETAVKKVIAEGKCRT 346

  Fly   352 KEFGGQDTGEYVICNIINQL 371
            |:.||..|.:.|:..:|.:|
plant   347 KDLGGTSTTQEVVDAVIAKL 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7755NP_611110.2 Iso_dh 51..371 CDD:294303 84/335 (25%)
IDH1NP_195252.1 PLN00123 8..367 CDD:215065 87/346 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11835
Phylome 1 0.910 0.800 Consistency score
22.010

Return to query results.
Submit another query.