DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7755 and IDH2

Sequence 1:NP_611110.2 Gene:CG7755 FlyBaseID:FBgn0034105 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_179304.1 Gene:IDH2 AraportID:AT2G17130 Length:367 Species:Arabidopsis thaliana

Alignment Length:350 Identity:85/350 (24%)
Similarity:153/350 (44%) Gaps:29/350 (8%)


  Fly    35 GDARADPVNVLPKSKYGGINTVSLVTGTTIIGQQGAQFVSSLLSSSRVPVEVQVIEAGQD----- 94
            ||.:..||.::|....|     .|||..          |..::.:...||..:..|...|     
plant    33 GDGKPRPVTLIPGDGVG-----PLVTNA----------VQQVMEAMHAPVYFEPFEVHGDMKSLP 82

  Fly    95 DEYFHSVLRNRTAVH--VDNQADAEAKQKALKICNDLDLYVFKTRTRSFPGFKCRFPGVDIQLIG 157
            :....|:.:|:..:.  :............:.:..:|||:.......:.||...|...|||.:|.
plant    83 EGLLESIKKNKVCLKGGLKTPVGGGVSSLNVNLRKELDLFASLVNCFNLPGLASRHENVDIVVIR 147

  Fly   158 QNNMGIFNELEYSPVEGVVEALSVVSQKGNDKYLRYAFKAAAKAGRKRVTLINKAKEWPISDGSL 222
            :|..|.:..||:..|.||||:|.|:::..:::..:|||:.|....||:||.::||....::||..
plant   148 ENTEGEYAGLEHEVVPGVVESLKVITKFCSERIAKYAFEYAYLNNRKKVTAVHKANIMKLADGLF 212

  Fly   223 VEAAQRLHCHYKDCLELELMEVEEAISRLMTEPTYFDCLFASERYATFLSAICSGVCGGANLFSA 287
            :|:.|.:...|......|:: |:....:|:..|..||.:.....|...::...:|:.||..:...
plant   213 LESCQEVAKKYPSIAYNEII-VDNCCMQLVARPEQFDVMVTPNLYGNLVANTAAGIAGGTGVMPG 276

  Fly   288 VEIGDHHAVFKPLQT-----KLSLTNYANLSAYGIVSTIVDLFQHLGHDKCADALWCELKRTMDE 347
            ..:|..:|||:...:     |.:.....|.:...::.:...:.:||.....||.|...:||.:.|
plant   277 GNVGAEYAVFEQGASAGNVGKDTTEEQKNANPVALLLSSAMMLRHLQFPSFADRLETAVKRVIAE 341

  Fly   348 G-IRTKEFGGQDTGEYVICNIINQL 371
            | .||::.||..|.:.|:..:|..|
plant   342 GNCRTEDLGGNSTTQEVVDAVIANL 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7755NP_611110.2 Iso_dh 51..371 CDD:294303 79/333 (24%)
IDH2NP_179304.1 PLN00123 8..367 CDD:215065 85/350 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11835
Phylome 1 0.910 0.800 Consistency score
22.010

Return to query results.
Submit another query.