DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7755 and idh3g

Sequence 1:NP_611110.2 Gene:CG7755 FlyBaseID:FBgn0034105 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001230101.1 Gene:idh3g ZFINID:ZDB-GENE-050417-435 Length:391 Species:Danio rerio

Alignment Length:339 Identity:98/340 (29%)
Similarity:167/340 (49%) Gaps:20/340 (6%)


  Fly    46 PKSKYGGINTVSLVTGTTIIGQQGAQFVSSLLSSSRVPVEVQVIEAG----QDDEYFHSVL---R 103
            |.:||||.:||:|:.|.. ||.:....|..|...|.|||:.:|:...    .:|:..::::   |
Zfish    44 PPAKYGGRHTVTLIPGDG-IGPELLNHVRELFRFSCVPVDFEVVHVNSSSTSEDDISNAIMAIRR 107

  Fly   104 NRTA----VHVDNQADAEAKQKALKICNDLDLYVFKTRTRSFPGFKCRFPGVDIQLIGQNNMGIF 164
            |..|    :..::......|.:...:...||||......:|.||.:.|...:||.:|.:|..|.:
Zfish   108 NGVALKGNIETNHTMPPNHKSRNNLLRTSLDLYANVMHCQSLPGVQTRHKNIDIIIIRENTEGEY 172

  Fly   165 NELEYSPVEGVVEALSVVSQKGNDKYLRYAFKAAAKAGRKRVTLINKAKEWPISDGSLVEAAQRL 229
            :.||:....||||.|.::::..:.:...||||.|.:.||:|||.::||....:.||..::..:.:
Zfish   173 SSLEHESASGVVECLKIITRNNSLRIADYAFKLAREKGRRRVTAVHKANIMKLGDGLFLQCCKEV 237

  Fly   230 HCHYKDCLELELMEVEEAISRLMTEPTYFDCLFASERYATFLSAICSGVCGGANLFSAVEIGDHH 294
            ...|.| :|.|.|.|:....:|:::|..||.:.....|...:|.:|:|:.||..|......|..:
Zfish   238 ASGYPD-IEFENMIVDNTTMQLVSKPYQFDVMVMPNLYGNVVSNVCAGLVGGPGLVPGANYGRDY 301

  Fly   295 AVFKPL--QTKLSLT--NYANLSAYGIVSTIVDLFQHLGHDKCADALWCELKRTMDE-GIRTKEF 354
            |||:..  .|..|:.  |.||.:|..:.|.:  :..||.....|:.:...:..||:| .:.|.:.
Zfish   302 AVFETATRNTGKSIANRNIANPTAMLLASCL--MLDHLKLHDYANMIRSAILTTMNETRLHTVDI 364

  Fly   355 GGQDTGEYVICNII 368
            |||.|...|:.:|:
Zfish   365 GGQGTTSEVVQSIM 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7755NP_611110.2 Iso_dh 51..371 CDD:294303 95/335 (28%)
idh3gNP_001230101.1 mito_nad_idh 49..381 CDD:272942 95/335 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11835
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.