DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7755 and IDH3G

Sequence 1:NP_611110.2 Gene:CG7755 FlyBaseID:FBgn0034105 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_004126.1 Gene:IDH3G HGNCID:5386 Length:393 Species:Homo sapiens

Alignment Length:342 Identity:96/343 (28%)
Similarity:169/343 (49%) Gaps:19/343 (6%)


  Fly    46 PKSKYGGINTVSLVTGTTIIGQQGAQFVSSLLSSSRVPV---EVQVIEAGQDDEYFHSVL---RN 104
            |.:||||.:||:::.|.. ||.:....|.|:...:.|||   ||.|.....:::..::::   ||
Human    47 PSAKYGGRHTVTMIPGDG-IGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRN 110

  Fly   105 RTA----VHVDNQADAEAKQKALKICNDLDLYVFKTRTRSFPGFKCRFPGVDIQLIGQNNMGIFN 165
            |.|    :..::......|.:...:...||||......:|.||...|...:||.::.:|..|.::
Human   111 RVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYS 175

  Fly   166 ELEYSPVEGVVEALSVVSQKGNDKYLRYAFKAAAKAGRKRVTLINKAKEWPISDGSLVEAAQRLH 230
            .||:..|.||||:|.::::..:.:...||||.|.::|||:||.::||....:.||..::..:.:.
Human   176 SLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVA 240

  Fly   231 CHYKDCLELELMEVEEAISRLMTEPTYFDCLFASERYATFLSAICSGVCGGANLFSAVEIGDHHA 295
            ..|.. :..|.|.|:....:|::.|..||.:.....|...::.:|:|:.||..|.:....|..:|
Human   241 ARYPQ-ITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYGHVYA 304

  Fly   296 VFKPL--QTKLSLT--NYANLSAYGIVSTIVDLFQHLGHDKCADALWCELKRTMD-EGIRTKEFG 355
            ||:..  .|..|:.  |.||.:|..:.|.:  :..||.....|.::...:..:|| |.:.|.:.|
Human   305 VFETATRNTGKSIANKNIANPTATLLASCM--MLDHLKLHSYATSIRKAVLASMDNENMHTPDIG 367

  Fly   356 GQDTGEYVICNIINQLR 372
            ||.|....|.::|..:|
Human   368 GQGTTSEAIQDVIRHIR 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7755NP_611110.2 Iso_dh 51..371 CDD:294303 92/335 (27%)
IDH3GNP_004126.1 mito_nad_idh 52..383 CDD:272942 92/335 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11835
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.