DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7755 and idhg-2

Sequence 1:NP_611110.2 Gene:CG7755 FlyBaseID:FBgn0034105 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_491989.1 Gene:idhg-2 WormBaseID:WBGene00016266 Length:373 Species:Caenorhabditis elegans

Alignment Length:358 Identity:106/359 (30%)
Similarity:180/359 (50%) Gaps:30/359 (8%)


  Fly    27 SVRAAYAKGDARADPVNVLPKSKYGGINTVSLVTGTTIIGQQGAQFVSSLLSSSRVPV---EVQV 88
            :||.|.:.......|.:.||.:||||.:||..:.|.. ||.:....:.::.|....||   ||||
 Worm     9 AVRGAASAIRTHQIPGHRLPLAKYGGRHTVCALPGDG-IGPEMIAHIRNIFSFCHAPVNFEEVQV 72

  Fly    89 IEA---GQDDEYFHSVLRNRTAVHVDNQA---DAEAKQKALKICNDLDLYVFKTRTRSFPGFKCR 147
            ..:   |..|....::.||..|:..:.:.   |.:...:.:::...||||.......:.|....|
 Worm    73 SSSLLDGDMDAAMLAIERNGVAIKGNIETKHDDPQFNSRNVELRTKLDLYANILHCVTIPTVPTR 137

  Fly   148 FPGVDIQLIGQNNMGIFNELEYSPVEGVVEALSVVSQKGNDKYLRYAFKAAAKAGRKRVTLINKA 212
            ..|:||.||.:|..|.::.||:..|.|:||::.:|:::..::..|.||:.|...|||:||.::||
 Worm   138 HSGIDIVLIRENTEGEYSGLEHEAVPGIVESIKIVTREKIERISRMAFEYAKANGRKKVTAVHKA 202

  Fly   213 KEWPISDGSLVEAAQRLHCHYKDCLELELMEVEEAISRLMTEPTYFDCLFASERYATFLSAICSG 277
            ....:.||..::..:.:...||| ::.|.|.|:.|..:|:::|..||.:.....|...:|.|..|
 Worm   203 NIQKLGDGLFLKVVRDMSEDYKD-IKFEAMIVDNASMQLVSKPQQFDVMVMPNLYGNIISNIACG 266

  Fly   278 VCGGANLFSAVEIGDHHAVF----KPLQTKLSLTNYANLSAYGIVSTIVDLFQHLGHDKC----- 333
            :.||..|.|.:.:||.:|||    :...|.|:..:.||.:|:  :...||:.::||   |     
 Worm   267 LVGGPGLVSGMNLGDKYAVFETGTRNTGTSLAGKDIANPTAF--IRASVDMLRYLG---CHYHAN 326

  Fly   334 --ADALWCELKRTMDEGIRTKEFGGQDTGEYVI 364
              :||||   |..:::.|.|.:.||.::...||
 Worm   327 IISDALW---KALVEQRIHTADIGGNNSASDVI 356

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7755NP_611110.2 Iso_dh 51..371 CDD:294303 98/335 (29%)
idhg-2NP_491989.1 Iso_dh 33..363 CDD:294303 98/335 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11835
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.870

Return to query results.
Submit another query.