DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7755 and idh3b

Sequence 1:NP_611110.2 Gene:CG7755 FlyBaseID:FBgn0034105 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_012809570.1 Gene:idh3b XenbaseID:XB-GENE-5825105 Length:381 Species:Xenopus tropicalis

Alignment Length:384 Identity:89/385 (23%)
Similarity:175/385 (45%) Gaps:33/385 (9%)


  Fly    16 SVRHFADEIHGSVRAAYAKGDARADPVNVLP------KSKYGGINTVSLVTGTTIIGQQGAQFVS 74
            ::|||   :..:....|.:......|:...|      ..|..|...|:::.|.. :|.:....|.
 Frog     3 ALRHF---LRSTQTQLYPQISLARRPLCTSPLVQQAEPGKSDGAFHVTMIPGDG-VGPELMHSVR 63

  Fly    75 SLLSSSRVPV--------EVQVIEAGQD-DEYFHSVLRNRTA----VHVDNQADAEAKQKALKIC 126
            .:..::.|||        |||.:.:.:. ||...|:..|:.|    :|...:...|.....:::.
 Frog    64 EVFKAADVPVEFDEHHLSEVQNMASKEKLDEVLASMQANKVAIKGKIHTPMEYKGELASYEMRLR 128

  Fly   127 NDLDLYVFKTRTRSFPGFKCRFPGVDIQLIGQNNMGIFNELEYSPVEGVVEALSVVSQKGNDKYL 191
            ..|||:.......|.||:|.|...:|:.:|.:...|.::.||:..|.||:|.|.:::::.:::..
 Frog   129 RKLDLFANVVHVNSLPGYKTRHNNLDLVIIREQTEGEYSSLEHESVSGVIECLKIITREKSNRIA 193

  Fly   192 RYAFKAAAKAGRKRVTLINKAKEWPISDGSLVEAAQRLHCHYKDCLELELMEVEEAISRLMTEPT 256
            ::||..|.|.||.:||.::||....:.||..::..:.:...|.. ::.:.|.::....:|:..|.
 Frog   194 KFAFDYATKKGRSKVTAVHKANIMKLGDGLFLQCCKEVAQLYPK-IQFDTMIIDNCCMQLVQNPY 257

  Fly   257 YFDCLFASERYATFLSAICSGVCGGANLFSAVEIGDHHAVFK-----PLQTKLSLTNYANLSAYG 316
            .||.|.....|...:..:.:|:.|||.:.........:|||:     |....:. .|.||.:|..
 Frog   258 QFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVG-RNIANPTAML 321

  Fly   317 IVSTIVDLFQHLGHDKCADALWCELKRTMDEG-IRTKEFGGQDTGEYVICNIINQLRCR 374
            :.:|  ::.:||..:..::.:...:|:.:.:| :||::.||..|....|..:|:.|..|
 Frog   322 LSAT--NMLRHLNLEYHSNLISDAVKKVIKQGKVRTRDMGGYSTTTDFIKAVIDGLHYR 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7755NP_611110.2 Iso_dh 51..371 CDD:294303 80/339 (24%)
idh3bXP_012809570.1 Iso_dh 42..375 CDD:294303 80/338 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.