DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7755 and LOC100125384

Sequence 1:NP_611110.2 Gene:CG7755 FlyBaseID:FBgn0034105 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001096833.1 Gene:LOC100125384 RGDID:1642415 Length:395 Species:Rattus norvegicus

Alignment Length:348 Identity:98/349 (28%)
Similarity:176/349 (50%) Gaps:25/349 (7%)


  Fly    43 NVLPKSKYGGINTVSLVTGTTIIGQQGAQFVSSLLSSSRVPVEVQVIEA---GQDDEYFHSVL-- 102
            :|.|..||||.:||:::.|.. ||.:....|..:..|:.||||.:.:.|   ..::|..::::  
  Rat    41 SVPPSPKYGGKHTVTMIPGDG-IGPELMVHVKRIFRSNCVPVEFEEVWATSTSSEEEINNALMAI 104

  Fly   103 -RNRTA----VHVDNQADAEAKQKALKICNDLDLYVFKTRTRSFPGFKCRFPGVDIQLIGQNNMG 162
             |||..    :..::...|:.|....|....||||......::|||.:.|...:||.::.:|..|
  Rat   105 RRNRITLKGNIATNHHLPAKYKSHNTKFRTALDLYASVVHFKTFPGVETRHKDIDILVVRENTEG 169

  Fly   163 IFNELEYSPVEGVVEALSVVSQKGNDKYLRYAFKAAAKAGRKRVTLINKAKEWPISDGSLVEAAQ 227
            .:..||:..|.||||:|.:|::..:.:...|||:.|.|.|||:||:::||....:.||..::..:
  Rat   170 EYTNLEHESVRGVVESLKIVTKTKSVRIADYAFRLAQKMGRKKVTVVHKANIMKLGDGLFLQCCK 234

  Fly   228 RLHCHYKDCLELELMEVEEAISRLMTEPTYFDCLFASERYATFLSAICSGVCGGANLFSAVEIGD 292
            .:..||.. :.||.|.::....:|:::|..||.:.....|...::::|:|:.||:.:......||
  Rat   235 DVAAHYPQ-ITLESMIIDNTAMQLVSKPQQFDVMLMPNLYGNIINSVCTGLVGGSGIVPGANYGD 298

  Fly   293 HHAVF----KPLQTKLSLTNYANLSAYGIVSTI----VDLFQHLGHDKCADALWCELKRTMDEGI 349
            .:|:|    |.:...|:..|.||..|..:.|.|    :||..:..|.:.|     .:....::.|
  Rat   299 SYAIFETGSKEIGQDLAHRNIANPVAMLLTSCIMLDYLDLQLYAAHIRSA-----VMASLQNKSI 358

  Fly   350 RTKEFGGQDTGEYVICNIINQLR 372
            .|.:.|||.|...|:..|::.::
  Rat   359 CTPDIGGQGTTAGVVEYILDHMK 381

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7755NP_611110.2 Iso_dh 51..371 CDD:294303 94/338 (28%)
LOC100125384NP_001096833.1 Iso_dh 49..380 CDD:294303 94/338 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11835
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.