DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7786 and hlfa

Sequence 1:NP_611101.1 Gene:CG7786 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001070802.1 Gene:hlfa ZFINID:ZDB-GENE-061013-159 Length:294 Species:Danio rerio

Alignment Length:191 Identity:62/192 (32%)
Similarity:89/192 (46%) Gaps:35/192 (18%)


  Fly     4 PAQSPILDVTETVSMHSELDAELESKNNPSYSISIPQNLRLTGLGFPGMIGAKRSSETLPAFEYI 68
            |.|.|....|.:|...|..|      |:.|::..:.||.    |..|...|...|.:|       
Zfish   112 PLQPPSAPPTPSVVDLSNRD------NSSSHNGMVAQNC----LQNPTRPGLPASRDT------- 159

  Fly    69 APPSHALQALEFPL------MELNRVGVIGGGMFPGFVHRRVRGEKRP-----------IPEAQK 116
             |......:::.||      .:|....|.|..:|.....:....|.:|           |||..|
Zfish   160 -PSPIDPDSIQVPLAYEPDPADLALSSVPGQEIFDPRKRKFSAEELKPQPMIKKARKVFIPEDLK 223

  Fly   117 DAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQLL 177
            |.:|:.||::||.|||||||||:::|::||.||..||:||:.|||:|..||.||...:.:|
Zfish   224 DDRYWARRRKNNIAAKRSRDARRLKENQIAIRAGFLEKENAALRAEVADLRKELGRCKNVL 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 33/59 (56%)
coiled coil 117..175 CDD:269843 32/58 (55%)
hlfaNP_001070802.1 bZIP_HLF 223..282 CDD:269843 33/59 (56%)
coiled coil 224..282 CDD:269843 32/58 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112128357
eggNOG 1 0.900 E1_KOG3119
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000600
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11988
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.