DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and hlfa

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001070802.1 Gene:hlfa / 768192 ZFINID:ZDB-GENE-061013-159 Length:294 Species:Danio rerio


Alignment Length:191 Identity:62/191 - (32%)
Similarity:89/191 - (46%) Gaps:35/191 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PAQSPILDVTETVSMHSELDAELESKNNPSYSISIPQNLRLTGLGFPGMIGAKRSSETLPAFEYI 68
            |.|.|....|.:|...|..|      |:.|::..:.||.    |..|...|...|.:|       
Zfish   112 PLQPPSAPPTPSVVDLSNRD------NSSSHNGMVAQNC----LQNPTRPGLPASRDT------- 159

  Fly    69 APPSHALQALEFPL------MELNRVGVIGGGMFPGFVHRRVRGEKRP-----------IPEAQK 116
             |......:::.||      .:|....|.|..:|.....:....|.:|           |||..|
Zfish   160 -PSPIDPDSIQVPLAYEPDPADLALSSVPGQEIFDPRKRKFSAEELKPQPMIKKARKVFIPEDLK 223

  Fly   117 DAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQLL 177
            |.:|:.||::||.|||||||||:::|::||.||..||:||:.|||:|..||.||...:.:|
Zfish   224 DDRYWARRRKNNIAAKRSRDARRLKENQIAIRAGFLEKENAALRAEVADLRKELGRCKNVL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 33/58 (57%)
coiled coil 117..175 CDD:269843 32/57 (56%)
hlfaNP_001070802.1 bZIP_HLF 223..282 CDD:269843 33/58 (57%)
coiled coil 224..282 CDD:269843 32/57 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586462
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.700

Return to query results.
Submit another query.