DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7786 and TEF

Sequence 1:NP_611101.1 Gene:CG7786 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_003207.1 Gene:TEF HGNCID:11722 Length:303 Species:Homo sapiens

Alignment Length:206 Identity:65/207 (31%)
Similarity:91/207 (44%) Gaps:43/207 (21%)


  Fly     8 PILDVT---ETVSMHSE---LDAELESKNNPSYSISIPQNLRLTGLGFPGMIGAKRSSETLPAFE 66
            ||.|.|   :..|.|.|   ||..|.....|:....:..||.|......|...|..|:.:.|:..
Human    81 PIWDKTIPYDGESFHLEYMDLDEFLLENGIPASPTHLAHNLLLPVAELEGKESASSSTASPPSSS 145

  Fly    67 -YIAPPSHALQALEFPL-------------------------MELNRVGVIGGGMFPGFVHRRVR 105
             .|..||..:.:.|..|                         .:|....|.||.:|....|:...
Human   146 TAIFQPSETVSSTESSLEKERETPSPIDPNCVEVDVNFNPDPADLVLSSVPGGELFNPRKHKFAE 210

  Fly   106 GEKRP-----------IPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSIL 159
            .:.:|           :|:.|||.||:.|||:||.|||||||||:::|::|..|||.||:||:.|
Human   211 EDLKPQPMIKKAKKVFVPDEQKDEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTAL 275

  Fly   160 RAQVLALRDEL 170
            |.:|..||.|:
Human   276 RTEVAELRKEV 286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 33/56 (59%)
coiled coil 117..175 CDD:269843 32/55 (58%)
TEFNP_003207.1 bZIP_HLF 232..290 CDD:269843 33/56 (59%)
coiled coil 233..290 CDD:269843 32/55 (58%)
Basic motif. {ECO:0000255|PROSITE-ProRule:PRU00978} 235..255 16/20 (80%)
Leucine-zipper. {ECO:0000255|PROSITE-ProRule:PRU00978} 256..263 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112131014
eggNOG 1 0.900 E1_KOG3119
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000600
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11988
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.