DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7786 and Hlf

Sequence 1:NP_611101.1 Gene:CG7786 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_006220842.1 Gene:Hlf RGDID:1582828 Length:296 Species:Rattus norvegicus

Alignment Length:195 Identity:56/196 (29%)
Similarity:87/196 (44%) Gaps:33/196 (17%)


  Fly     2 HSPAQSPILDVTETVSMHSELDAELESKNNPSYSISIPQNLRLTGLGFPG-MIGAKRSSETLPAF 65
            |||....:...:.|.....:|.:...:..:|             |:..|. |....|..:.|||.
  Rat   106 HSPHPPGLQPASSTAPSVMDLSSRATAPLHP-------------GIPSPNCMQNPIRPGQLLPAN 157

  Fly    66 EYIAPPSHALQALEFPL------MELNRVGVIGGGMFPGFVHRRVRGEKRPIP------------ 112
            .....|... ..::.|:      .:|....:.|..||.....:....|.:|.|            
  Rat   158 RNTPSPIDP-DTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPD 221

  Fly   113 EAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQLL 177
            :.::|.||:.||::||.|||||||||:::|::||.||:.||:|||.||.:|..||.||...:.:|
  Rat   222 DLKQDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNIL 286

  Fly   178  177
              Rat   287  286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 33/59 (56%)
coiled coil 117..175 CDD:269843 33/58 (57%)
HlfXP_006220842.1 bZIP_HLF 226..284 CDD:269843 33/58 (57%)
coiled coil 226..284 CDD:269843 33/58 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112129217
eggNOG 1 0.900 E1_KOG3119
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000600
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11988
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
65.890

Return to query results.
Submit another query.