DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7786 and cebpb

Sequence 1:NP_611101.1 Gene:CG7786 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001030293.1 Gene:cebpb XenbaseID:XB-GENE-479779 Length:145 Species:Xenopus tropicalis

Alignment Length:143 Identity:40/144 (28%)
Similarity:58/144 (40%) Gaps:17/144 (12%)


  Fly    34 YSISIPQNLRLTGLGFPGMIGAKRSSETLPAFEYIAPPSHALQALEFPLMELNRVGVIGGGMFPG 98
            ||:......:....|..|.|.:..||.:.|     ..|:        ||.  |:.|...|....|
 Frog     5 YSVRAYLGYQTVPSGSSGNISSASSSSSPP-----GTPN--------PLE--NKSGGPSGATGGG 54

  Fly    99 FVHRRVRGEKRPIPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQV 163
            :........|:.:.:...:.|.  ||:|||.|.::|||..|||......:...|..||..|:.:|
 Frog    55 YGKSGSSKGKKSLDKHSDEYKI--RRERNNIAVRKSRDKAKIRNMETQHKVLELSAENERLQKRV 117

  Fly   164 LALRDELQTVRQL 176
            ..|..||.|:|.|
 Frog   118 EQLSRELSTLRNL 130

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 23/59 (39%)
coiled coil 117..175 CDD:269843 23/58 (40%)
cebpbNP_001030293.1 bZIP_CEBPB 67..134 CDD:269860 24/67 (36%)
coiled coil 71..132 CDD:269860 24/63 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.