DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7786 and hlfb

Sequence 1:NP_611101.1 Gene:CG7786 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_005156391.1 Gene:hlfb ZFINID:ZDB-GENE-110420-3 Length:300 Species:Danio rerio

Alignment Length:212 Identity:60/213 (28%)
Similarity:89/213 (42%) Gaps:53/213 (25%)


  Fly     3 SPAQSPILDVTETVSMHSELDAELESKNNPSYSISIPQNLRLTGLGFPGMIG----AKRSSETL- 62
            ||||.     .:.:..|.....:.:........:|:||          |.|.    :.||..|. 
Zfish    95 SPAQH-----DQNLHQHHHQQQQQQQHQQQQQQVSMPQ----------GPISVMDLSSRSIHTAI 144

  Fly    63 --------PAFEYIAPPSHAL------QALEFPL------MELNRVGVIGGGMFPGFVHRRVRGE 107
                    |. ..:.|||...      :||..|:      .:|....|.|..:|.....:....|
Zfish   145 SPQNCLHSPG-RSVLPPSRNTPSPVDPEALHIPVSYEPDPADLALSSVPGQEVFDPRKRKFSEEE 208

  Fly   108 KRPIP------------EAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILR 160
            .:|.|            :.::|.||:.||::||.|||||||||:::|::||.||..||:||..||
Zfish   209 LKPQPMIKKARKIFIPDDLKQDEKYWARRRKNNVAAKRSRDARRLKENQIAIRAGFLEKENMALR 273

  Fly   161 AQVLALRDELQTVRQLL 177
            .:|..||.||...:.:|
Zfish   274 QEVADLRKELGRCKNIL 290

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 32/59 (54%)
coiled coil 117..175 CDD:269843 32/58 (55%)
hlfbXP_005156391.1 bZIP_HLF 230..288 CDD:269843 32/58 (55%)
coiled coil 230..288 CDD:269843 32/58 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112128354
eggNOG 1 0.900 E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000600
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11988
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.