DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and nfil3-6

DIOPT Version :10

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001002218.2 Gene:nfil3-6 / 431765 ZFINID:ZDB-GENE-040704-63 Length:370 Species:Danio rerio


Alignment Length:63 Identity:28/63 - (44%)
Similarity:45/63 - (71%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 RGEKRPIPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALR 167
            |.::..||..:||..|:::||:|||||||||:.|::.:..:..|...|.:||:.|||::|||:
Zfish    62 RRKREFIPHEKKDDGYWDKRKKNNEAAKRSREKRRVNDMVLENRVLTLLEENARLRAELLALK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 25/52 (48%)
coiled coil 117..175 CDD:269843 24/51 (47%)
nfil3-6NP_001002218.2 bZIP_NFIL3 73..132 CDD:269842 25/52 (48%)
coiled coil 74..132 CDD:269842 24/51 (47%)

Return to query results.
Submit another query.