DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7786 and slbo

Sequence 1:NP_611101.1 Gene:CG7786 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001286836.1 Gene:slbo FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster

Alignment Length:59 Identity:20/60 (33%)
Similarity:40/60 (67%) Gaps:2/60 (3%)


  Fly   119 KYFERRKRNNEAAKRSRDARKIREDRIAFRA-ALLEQENSILRAQVLALRDELQTVRQL 176
            :|..||:|||.|.::||:..|:|...:..|. :||:::::::| |:..:.:|||..:|:
  Fly   365 EYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIR-QLGEMTNELQLHKQI 422

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 19/57 (33%)
coiled coil 117..175 CDD:269843 19/57 (33%)
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 19/56 (34%)
coiled coil 363..420 CDD:269841 19/56 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3119
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.