DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7786 and vri

Sequence 1:NP_611101.1 Gene:CG7786 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001137792.1 Gene:vri FlyBaseID:FBgn0016076 Length:729 Species:Drosophila melanogaster

Alignment Length:95 Identity:34/96 (35%)
Similarity:59/96 (61%) Gaps:8/96 (8%)


  Fly   105 RGEKRPIPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDE 169
            |.::...|:.:||..|::||:||||||||||:.|:..:..:..|...|.:||.:|:||:.|:||:
  Fly   227 RKQREFTPDNKKDESYWDRRRRNNEAAKRSREKRRYNDMVLEQRVIELTKENHVLKAQLDAIRDK 291

  Fly   170 -------LQTVRQLLGA-TTAGGMLSMARQ 191
                   |.:|.::|.: .|:..:||..::
  Fly   292 FNISGENLVSVEKILASLPTSEQVLSNTKR 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 28/66 (42%)
coiled coil 117..175 CDD:269843 27/65 (42%)
vriNP_001137792.1 bZIP_NFIL3 238..297 CDD:269842 26/59 (44%)
coiled coil 239..297 CDD:269842 25/58 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3119
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.