| Sequence 1: | NP_611101.1 | Gene: | CG7786 / 36802 | FlyBaseID: | FBgn0034096 | Length: | 192 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005257326.1 | Gene: | HLF / 3131 | HGNCID: | 4977 | Length: | 296 | Species: | Homo sapiens | 
| Alignment Length: | 195 | Identity: | 56/195 - (28%) | 
|---|---|---|---|
| Similarity: | 86/195 - (44%) | Gaps: | 36/195 - (18%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     2 HSPAQSPILDVTETVSMHSELDAELESKNNPSYSISIPQNLRLTGLGFPG-MIGAKRSSETLPAF 65 
  Fly    66 EYIAPPSHALQALEFPL------MELNRVGVIGGGMFPGFVHRRVRGEKRPIP------------ 112 
  Fly   113 EAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQLL 177 
  Fly   178  177 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG7786 | NP_611101.1 | bZIP_HLF | 116..175 | CDD:269843 | 33/58 (57%) | 
| coiled coil | 117..175 | CDD:269843 | 33/57 (58%) | ||
| HLF | XP_005257326.1 | bZIP_HLF | 226..284 | CDD:269843 | 33/57 (58%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165151879 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3119 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000980 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.700 | |||||