DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7786 and HLF

Sequence 1:NP_611101.1 Gene:CG7786 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_005257326.1 Gene:HLF HGNCID:4977 Length:296 Species:Homo sapiens

Alignment Length:195 Identity:56/196 (29%)
Similarity:86/196 (44%) Gaps:36/196 (18%)


  Fly     2 HSPAQSPILDVTETVSMHSELDAELESKNNPSYSISIPQNLRLTGLGFPG-MIGAKRSSETLPAF 65
            |.|...|......:|   .:|.:...:..:|             |:..|. |....|..:.|||.
Human   109 HPPGLQPASSAAPSV---MDLSSRASAPLHP-------------GIPSPNCMQSPIRPGQLLPAN 157

  Fly    66 EYIAPPSHALQALEFPL------MELNRVGVIGGGMFPGFVHRRVRGEKRPIP------------ 112
            .....|... ..::.|:      .:|....:.|..||.....:....|.:|.|            
Human   158 RNTPSPIDP-DTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPD 221

  Fly   113 EAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQLL 177
            :.::|.||:.||::||.|||||||||:::|::||.||:.||:|||.||.:|..||.||...:.:|
Human   222 DLKQDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNIL 286

  Fly   178  177
            Human   287  286

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 33/59 (56%)
coiled coil 117..175 CDD:269843 33/58 (57%)
HLFXP_005257326.1 bZIP_HLF 226..284 CDD:269843 33/58 (57%)
coiled coil 226..284 CDD:269843 33/58 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112129186
eggNOG 1 0.900 E1_KOG3119
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000600
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11988
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.