DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7786 and gt

Sequence 1:NP_611101.1 Gene:CG7786 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_525049.1 Gene:gt FlyBaseID:FBgn0001150 Length:448 Species:Drosophila melanogaster

Alignment Length:55 Identity:32/56 (57%)
Similarity:43/56 (77%) Gaps:0/56 (0%)


  Fly   116 KDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDEL 170
            |||.|:|||::||.|||:|||.|:|:||.||.|||.||::|..|..|:.||:.:|
  Fly   383 KDAAYYERRRKNNAAAKKSRDRRRIKEDEIAIRAAYLERQNIELLCQIDALKVQL 437

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 32/56 (57%)
coiled coil 117..175 CDD:269843 31/55 (56%)
gtNP_525049.1 bZIP_HLF 383..440 CDD:269843 32/56 (57%)
coiled coil 384..440 CDD:269843 31/55 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3119
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11988
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.