DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and Tef

DIOPT Version :8

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_062067.2 Gene:Tef / 29362 RGDID:3841 Length:301 Species:Rattus norvegicus

Alignment Length:206 Identity:66/206 - (32%)
Similarity:92/206 - (44%) Gaps:43/206 - (20%)


  Fly     8 PILDVT---ETVSMHSE---LDAELESKNNPSYSISIPQNLRLTGLGFPGMIGAKRSSETLPAFE 66
            ||.|.|   :..|.|.|   ||..|.....|:....:.|||.|......|...|..|:.:.|:..
  Rat    79 PIWDKTIPYDGESFHLEYMDLDEFLLENGIPASPTHLAQNLLLPVAELEGKESASSSTASPPSSS 143

  Fly    67 -YIAPPSHALQALEFPL-------------------------MELNRVGVIGGGMFPGFVHRRVR 105
             .|..||..:.:.|..|                         .:|....|.||.:|....|:...
  Rat   144 TAIFQPSETVSSTESSLEKERETPSPIDPNCVEVDVNFNPDPADLVLSSVPGGELFNPRKHKFAE 208

  Fly   106 GEKRP-----------IPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSIL 159
            .:.:|           :|:.|||.||:.|||:||.|||||||||:::|::|..|||.||:||:.|
  Rat   209 EDLKPQPMIKKAKKVFVPDEQKDEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTAL 273

  Fly   160 RAQVLALRDEL 170
            |.:|..||.|:
  Rat   274 RTEVAELRKEV 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 33/55 (60%)
coiled coil 117..175 CDD:269843 32/54 (59%)
TefNP_062067.2 bZIP_HLF 230..288 CDD:269843 33/55 (60%)
coiled coil 231..288 CDD:269843 32/54 (59%)
Basic motif. {ECO:0000255|PROSITE-ProRule:PRU00978} 233..253 15/19 (79%)
Leucine-zipper. {ECO:0000255|PROSITE-ProRule:PRU00978} 254..261 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112131029
eggNOG 1 0.900 E1_KOG3119
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000600
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11988
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
65.890

Return to query results.
Submit another query.