DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7786 and Cebpg

Sequence 1:NP_611101.1 Gene:CG7786 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_008757334.1 Gene:Cebpg RGDID:2330 Length:316 Species:Rattus norvegicus

Alignment Length:145 Identity:37/146 (25%)
Similarity:63/146 (43%) Gaps:18/146 (12%)


  Fly    35 SISIPQNLRLTGLGFPGMIGAKRSSETLPAFEYIAPPSHALQALEFPLMELNRVGVIGGGMFPGF 99
            |:.:.:..:::.|..|.      |:..:.....|...:||....:.|  :|...|..|||     
  Rat   158 SVLVEERAQMSKLSQPA------STAGVNGISVIHTQAHASGLQQVP--QLVPAGPGGGG----- 209

  Fly   100 VHRRV---RGEKRPIPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRA 161
              :.|   :..|:..|..:...:|.:||:|||.|.|:||...|.:......|...|::||..|.|
  Rat   210 --KAVPPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEA 272

  Fly   162 QVLALRDELQTVRQL 176
            ::..|..||..::.|
  Rat   273 KIKLLTKELSVLKDL 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 20/59 (34%)
coiled coil 117..175 CDD:269843 20/58 (34%)
CebpgXP_008757334.1 bZIP_CEBPG 226..286 CDD:269861 20/60 (33%)
coiled coil 228..286 CDD:269861 20/58 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.