DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7786 and Cebpa

Sequence 1:NP_611101.1 Gene:CG7786 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001274506.1 Gene:Cebpa RGDID:2326 Length:395 Species:Rattus norvegicus

Alignment Length:104 Identity:33/105 (31%)
Similarity:46/105 (44%) Gaps:9/105 (9%)


  Fly    71 PSHALQALEFPLMELNRVGVIGGGMFPGFVHRRVRGEKRPIPEAQKDAKYFERRKRNNEAAKRSR 135
            |..:|:.|..|..:|...|..|||...|...:.|         .:...:|..||:|||.|.::||
  Rat   282 PGGSLKGLAGPHPDLRTGGGGGGGAGAGKAKKSV---------DKNSNEYRVRRERNNIAVRKSR 337

  Fly   136 DARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVR 174
            |..|.|......:...|..:|..||.:|..|..||.|:|
  Rat   338 DKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLR 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 22/60 (37%)
coiled coil 117..175 CDD:269843 22/59 (37%)
CebpaNP_001274506.1 bZIP_CEBPA 317..377 CDD:269859 22/61 (36%)
coiled coil 319..377 CDD:269859 22/59 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.