DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and cebpg

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_571961.1 Gene:cebpg / 140816 ZFINID:ZDB-GENE-020111-5 Length:163 Species:Danio rerio


Alignment Length:162 Identity:38/162 - (23%)
Similarity:61/162 - (37%) Gaps:37/162 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MHSELDAELESKNNPSYSI--SIPQNLRLTGLGFPGMIGAKRSSETLPAFEYIAPPSHALQALEF 80
            |..:|..::.|.:....|:  :.|.|..|...|..|:       :.:|....:.|          
Zfish     1 MSKQLQQKISSTDQNGVSVIQNQPHNSALNPAGAAGL-------QQVPQLVPVNP---------- 48

  Fly    81 PLMELNRVGVIGGGMFPGFVHRRVRGEKRPIPEAQKDA-KYFERRKRNNEAAKRSRDARKIREDR 144
                       |||      .:.....|.......||: :|.:||:|||.|.|:||...|.:...
Zfish    49 -----------GGG------GKATAPSKMKKSNMDKDSDEYRQRRERNNLAVKKSRMRSKQKAQD 96

  Fly   145 IAFRAALLEQENSILRAQVLALRDELQTVRQL 176
            ...|...|::||..|.|::..|..||..::.|
Zfish    97 TQQRVNELKEENERLEAKIKLLSKELSVLKDL 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 22/59 (37%)
coiled coil 117..175 CDD:269843 21/58 (36%)
cebpgNP_571961.1 bZIP_CEBPG 67..127 CDD:269861 22/59 (37%)
coiled coil 69..127 CDD:269861 20/57 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.