DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and Cebpg

DIOPT Version :10

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_034014.1 Gene:Cebpg / 12611 MGIID:104982 Length:150 Species:Mus musculus


Alignment Length:130 Identity:36/130 - (27%)
Similarity:55/130 - (42%) Gaps:22/130 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PGMIGAKRSSETLPAFEYIAPPSHALQALEFPLMELNRVGVIGGGMFPGFVHRRV---RGEKRPI 111
            ||:.|          ...|...:||....:.|  :|...|..|||       :.|   :..|:..
Mouse    11 PGVNG----------ISVIHTQAHASGLQQVP--QLVPAGPGGGG-------KAVPPSKQSKKSS 56

  Fly   112 PEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQL 176
            |..:...:|.:||:|||.|.|:||...|.:......|...|::||..|.|::..|..||..::.|
Mouse    57 PMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDL 121

  Fly   177  176
            Mouse   122  121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 20/58 (34%)
coiled coil 117..175 CDD:269843 20/57 (35%)
CebpgNP_034014.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..94 20/75 (27%)
bZIP_CEBPG 60..120 CDD:269861 20/59 (34%)
coiled coil 62..120 CDD:269861 20/57 (35%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 66..93 10/26 (38%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 97..118 8/20 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..150
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.