DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and Cebpg

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_034014.1 Gene:Cebpg / 12611 MGIID:104982 Length:150 Species:Mus musculus


Alignment Length:130 Identity:36/130 - (27%)
Similarity:55/130 - (42%) Gaps:22/130 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PGMIGAKRSSETLPAFEYIAPPSHALQALEFPLMELNRVGVIGGGMFPGFVHRRV---RGEKRPI 111
            ||:.|          ...|...:||....:.|  :|...|..|||       :.|   :..|:..
Mouse    11 PGVNG----------ISVIHTQAHASGLQQVP--QLVPAGPGGGG-------KAVPPSKQSKKSS 56

  Fly   112 PEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQL 176
            |..:...:|.:||:|||.|.|:||...|.:......|...|::||..|.|::..|..||..::.|
Mouse    57 PMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDL 121

  Fly   177  176
            Mouse   122  121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 20/58 (34%)
coiled coil 117..175 CDD:269843 20/57 (35%)
CebpgNP_034014.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..94 20/75 (27%)
bZIP_CEBPG 60..120 CDD:269861 20/59 (34%)
coiled coil 62..120 CDD:269861 20/57 (35%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 66..93 10/26 (38%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 97..118 8/20 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..150
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - -
Hieranoid 00.000 Not matched by this tool.