DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7786 and Cebpg

Sequence 1:NP_611101.1 Gene:CG7786 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_034014.1 Gene:Cebpg MGIID:104982 Length:150 Species:Mus musculus

Alignment Length:130 Identity:36/131 (27%)
Similarity:55/131 (42%) Gaps:22/131 (17%)


  Fly    50 PGMIGAKRSSETLPAFEYIAPPSHALQALEFPLMELNRVGVIGGGMFPGFVHRRV---RGEKRPI 111
            ||:.|          ...|...:||....:.|  :|...|..|||       :.|   :..|:..
Mouse    11 PGVNG----------ISVIHTQAHASGLQQVP--QLVPAGPGGGG-------KAVPPSKQSKKSS 56

  Fly   112 PEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQL 176
            |..:...:|.:||:|||.|.|:||...|.:......|...|::||..|.|::..|..||..::.|
Mouse    57 PMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDL 121

  Fly   177  176
            Mouse   122  121

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 20/59 (34%)
coiled coil 117..175 CDD:269843 20/58 (34%)
CebpgNP_034014.1 bZIP_CEBPG 60..120 CDD:269861 20/60 (33%)
coiled coil 62..120 CDD:269861 20/58 (34%)
Basic motif. {ECO:0000255|PROSITE-ProRule:PRU00978} 66..93 10/27 (37%)
Leucine-zipper. {ECO:0000255|PROSITE-ProRule:PRU00978} 97..118 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.