DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and CEBPE

DIOPT Version :10

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001796.2 Gene:CEBPE / 1053 HGNCID:1836 Length:281 Species:Homo sapiens


Alignment Length:119 Identity:37/119 - (31%)
Similarity:55/119 - (46%) Gaps:24/119 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IAPPSHALQALEFPL-------MELNRVGVIGGGMFPGFVHRRVRGEKRPIPEAQKDA-KYFERR 124
            :|.|...|:.|:.||       ..|.:.....|.:..|         |:.:   .||: :|..||
Human   159 LAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKG---------KKAV---NKDSLEYRLRR 211

  Fly   125 KRNNEAAKRSRDARKIREDRIAFRAALLE--QENSILRAQVLALRDELQTVRQL 176
            :|||.|.::|||..|.|  .:..:..:||  .||..||::|..|..||.|:|.|
Human   212 ERNNIAVRKSRDKAKRR--ILETQQKVLEYMAENERLRSRVEQLTQELDTLRNL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 25/61 (41%)
coiled coil 117..175 CDD:269843 24/60 (40%)
CEBPENP_001796.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
PHA03247 <62..192 CDD:223021 7/32 (22%)
bZIP_CEBPE 202..262 CDD:269863 25/61 (41%)
coiled coil 204..262 CDD:269863 23/59 (39%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 208..228 10/19 (53%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 230..237 0/6 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.