DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7786 and CEBPB

Sequence 1:NP_611101.1 Gene:CG7786 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_005185.2 Gene:CEBPB HGNCID:1834 Length:345 Species:Homo sapiens

Alignment Length:74 Identity:25/75 (33%)
Similarity:39/75 (52%) Gaps:1/75 (1%)


  Fly   103 RVRGEKRPIPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALR 167
            :|:.:.:...:...| :|..||:|||.|.::|||..|:|......:...|..||..|:.:|..|.
Human   258 QVKSKAKKTVDKHSD-EYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLS 321

  Fly   168 DELQTVRQL 176
            .||.|:|.|
Human   322 RELSTLRNL 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 23/59 (39%)
coiled coil 117..175 CDD:269843 23/58 (40%)
CEBPBNP_005185.2 Required for Lys-174 sumoylation 1..24
Required for MYC transcriptional repression. {ECO:0000250|UniProtKB:P28033} 24..135
9aaTAD 116..124
bZIP_CEBPB 264..334 CDD:269860 24/69 (35%)
coiled coil 271..332 CDD:269860 24/62 (39%)
Basic motif. {ECO:0000255|PROSITE-ProRule:PRU00978} 275..295 10/20 (50%)
Leucine-zipper. {ECO:0000255|PROSITE-ProRule:PRU00978} 297..304 0/7 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.