DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7786 and thibz

Sequence 1:NP_611101.1 Gene:CG7786 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_017948046.1 Gene:thibz XenbaseID:XB-GENE-484679 Length:335 Species:Xenopus tropicalis

Alignment Length:142 Identity:44/143 (31%)
Similarity:63/143 (44%) Gaps:29/143 (20%)


  Fly    63 PAFEYIAPPSHALQALEF-PLMELNRVGVIGGGMF--------------------PGFVHRRVRG 106
            |..|..|||.....|.|. |...|    :.|.|:.                    |..:.||   
 Frog    21 PTLEAYAPPPQTQGADEISPSTSL----ISGSGLLLARSLLGCRNSHSSPTSCSSPCNIRRR--- 78

  Fly   107 EKRPIPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQ 171
             :...|:.:||..|:::|::|||||||||:.|:..:..:..|...|.:||:.|||::||||....
 Frog    79 -REFTPDEKKDDCYWDKRRKNNEAAKRSREKRRAGDLALEGRVIALLEENARLRAELLALRFRFG 142

  Fly   172 TVRQLLGATTAG 183
            .||.....|..|
 Frog   143 LVRDPCEETRGG 154

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 27/59 (46%)
coiled coil 117..175 CDD:269843 26/58 (45%)
thibzXP_017948046.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.