DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and 1300017J02Rik

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_082194.1 Gene:1300017J02Rik MGIID:1919025 Length:700 Species:Mus musculus

Alignment Length:780 Identity:176/781 (23%)
Similarity:281/781 (36%) Gaps:198/781 (25%)


  Fly    17 SISMCVAVQPPDDGKLRVCVVESR-----GVYRKTPKFCPLLEAKS-NIECVIGVDRLDCVRRIH 75
            ::.:|:|:   .:..:|.|||...     ..:|...|  .:|.|.. .:.||..:...:|:|.| 
Mouse    13 TLGLCLAL---PEKTIRWCVVSDHEATKCSSFRDNMK--KVLPAGGPAVTCVRKMSHPECIRDI- 71

  Fly    76 KGTAHFGVLTSEDLVAARWASVEILVASELRSH----------------ESHFEYEIVAVVDNHA 124
                      |.:.|.|......::..::|..|                ::|  |.:||:.....
Mouse    72 ----------SANKVDAVTVDGALVAEADLPHHSLKPIMAEYYGSKDDPKTH--YYVVAMAKKGT 124

  Fly   125 NIHTVHDLRGARLCHPGYGLGNHWTEVLANYFEAAMVSKTCDPEMTVTEDRIASTAKYFGPSCKA 189
            ... ::.|||.:.||.|.|....|...|:....:.              .|..:.|.:|..||  
Mouse   125 GFQ-LNQLRGKKSCHTGLGWSAGWYVPLSTLLPSG--------------SRETAAATFFSSSC-- 172

  Fly   190 GPWVP--DPKQDRILKNRYPSLCEMC----YEPDSCDQTDKHWGRRGALYCLTSGGGNVAWARLD 248
               ||  |.|.       :||||::|    .:..:|...:.::|..|||.||..|..:|::.:..
Mouse   173 ---VPCADGKM-------FPSLCQLCAGKGTDKCACSSREPYFGSWGALKCLQDGTADVSFVKHL 227

  Fly   249 DVRSHFGFSGIPAQSNPSDFSYLCPDGHLQPLNASQPCVWVAKPWPVVAARRSHAAQ--VQRLVT 311
            .|     |..:|.:::...:..||.|...:|:...:.|.....|..||.||.....:  :|.|:.
Mouse   228 TV-----FEAMPTKADRDQYELLCMDNTRRPVEEYEQCYLARVPSHVVVARSVDGKEDSIQELLR 287

  Fly   312 -----------------GLNHDEPDSWQNALLSLLETYHVFTVPLDNVIAIDDYLDQATAFQSAY 359
                             |..|.|...:.:|...||.      ||  ..|.|..||  ...|.||:
Mouse   288 VAQEHFGKDKSSPFQLFGSPHGEDLLFTDAAHGLLR------VP--RKIDISLYL--GYEFLSAF 342

  Fly   360 SFPECNPPRS------IVFCTTSIIQHIKC-SWLQEASQVYGVQPNIQCVRTMDEQQCLDNTKFK 417
            .    |..|.      :.:|.....:..|| .|    |.|.|  ..:.|......:.|:..|...
Mouse   343 R----NLKRGLEDSQRVKWCAVGQQERTKCDQW----SAVSG--GALACATEETPEDCIAATMKG 397

  Fly   418 ETDVVLVDQEMRVKAQRDYNLVPLLYEFAADMH--------------DRYVTIALVHKDAKFESF 468
            |.|.:.:|......|.. ..|||:|.|.....|              :.|..:|:|.|.....::
Mouse   398 EADAMSLDGGFAYVAGH-CGLVPVLAENYLSTHSSGRLGSKCVNAPLEGYYVVAVVKKSDVGITW 461

  Fly   469 RDLKGARACLPSFEGAAHLSVQET---------IVNATGKVQSLHSYFHR--------DSCLWNL 516
            :.|:|.::|        |.:|..:         |.|.||..: ..::|.|        ||.|..|
Mouse   462 KSLQGKKSC--------HTAVGTSEGWNVPMGLIYNQTGSCK-FDAFFSRSCAPGSDPDSPLCAL 517

  Fly   517 QSGRKCPLH---------YQGDEGALRCLSEGADVAFLSSDVYKKYVVGNLTSNWLTPGNHKDFR 572
            ..|...|.|         |.|..||||||.|..||||:......:...|.....|.....|:||.
Mouse   518 CVGGNNPAHMCAANNAEGYHGSSGALRCLVEKGDVAFMKHPTVLQNTDGKNPEPWAKGLKHEDFE 582

  Fly   573 VLCPYGGIEKRSNFEYCYLHWTTRGHLMTHNSSLTRRNE---IYNSLRDMDQLFGRKYKSETRPF 634
            :||..|..:..:..:.|:|      ..:.:.:..:|:::   :...|.:..:||||    ....:
Mouse   583 LLCLDGTRKPVTEAQSCHL------ARVPNRAVFSRKDKADFVRRILFNQQELFGR----NGFEY 637

  Fly   635 TLYGIFD-KRNNVLFRDDTDGLLGLQELHRDNAKRVMEHIYDRYANTQYYRNFDESGAMKSSHNL 698
            .::.:|: ...::||.|||:.|..||.          :..|..|...||....|......||..|
Mouse   638 MMFQMFESSAKDLLFSDDTECLSNLQN----------KTTYKTYLGPQYLTLMDNFRQCLSSELL 692

  Fly   699  698
            Mouse   693  692

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 85/382 (22%)
PBP2_transferrin 369..681 CDD:270247 82/363 (23%)
TR_FER 370..656 CDD:214514 78/331 (24%)
1300017J02RikNP_082194.1 PBP2_transferrin_N 24..346 CDD:270336 85/383 (22%)
Transferrin 25..346 CDD:278817 85/382 (22%)
PBP2_transferrin_C 352..684 CDD:270335 85/368 (23%)
TR_FER 355..685 CDD:214514 85/366 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KI0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S8250
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11485
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.820

Return to query results.
Submit another query.