DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and TF

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_001054.2 Gene:TF HGNCID:11740 Length:698 Species:Homo sapiens

Alignment Length:785 Identity:178/786 (23%)
Similarity:286/786 (36%) Gaps:218/786 (28%)


  Fly     7 ILVGLFASFLSISMCVAVQPPDDGKLRVCVVESRGVYRKTPKFCPLLEAKS-------------- 57
            :.||.......:.:|:||  ||                ||.::|.:.|.::              
Human     3 LAVGALLVCAVLGLCLAV--PD----------------KTVRWCAVSEHEATKCQSFRDHMKSVI 49

  Fly    58 -----NIECVIGVDRLDCVRRIHKGTAHFGVLTSEDLVAARWA--SVEILVASELRSHES-HFEY 114
                 ::.||.....|||:|.|....|....|.:..:..|..|  :::.:||....|.|. ...|
Human    50 PSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFY 114

  Fly   115 EIVAVVDNHANIHTVHDLRGARLCHPGYGLGNHWTEVLANYFEAAMVSKTCD-PEMTVTEDRIAS 178
            ..||||...:... ::.|||.:.||.|.|....|...:...:        || ||.....::  :
Human   115 YAVAVVKKDSGFQ-MNQLRGKKSCHTGLGRSAGWNIPIGLLY--------CDLPEPRKPLEK--A 168

  Fly   179 TAKYFGPSCKAGPWVPDPKQDRILKNRYPSLCEMCYEPD-SCDQTDKHWGRRGALYCLTSGGGNV 242
            .|.:|..||.       |..|   ...:|.||::|  |. .|...::::|..||..||..|.|:|
Human   169 VANFFSGSCA-------PCAD---GTDFPQLCQLC--PGCGCSTLNQYFGYSGAFKCLKDGAGDV 221

  Fly   243 AWARLDDVRSHFGFSGIPAQSNPSDFSYLCPDGHLQPLNASQPCVWVAKPWPVVAARRSHAAQVQ 307
            |:.:...:     |..:..:::...:..||.|...:|::..:.|.....|...|.||        
Human   222 AFVKHSTI-----FENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVAR-------- 273

  Fly   308 RLVTGLNHDEPDSWQNALLSLLE---------TYHVFTVPLDNVIAIDD---------------- 347
                .:...|...|:  ||:..:         .:.:|:.|....:...|                
Human   274 ----SMGGKEDLIWE--LLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKM 332

  Fly   348 YL--DQATAFQSAYS-------FPECNPPRSIVFCTTSIIQHIKC-SWLQEASQVYGVQPNIQCV 402
            ||  :..||.::...       ..||.|   :.:|..|..:.:|| .|     .|..| ..|:||
Human   333 YLGYEYVTAIRNLREGTCPEAPTDECKP---VKWCALSHHERLKCDEW-----SVNSV-GKIECV 388

  Fly   403 RTMDEQQCLDNTKFKETDVVLVDQEMRVKAQRDYNLVPLL---YEFAADMHDR----YVTIALVH 460
            .....:.|:......|.|.:.:|... |.......|||:|   |..:.:..|.    |..||:|.
Human   389 SAETTEDCIAKIMNGEADAMSLDGGF-VYIAGKCGLVPVLAENYNKSDNCEDTPEAGYFAIAVVK 452

  Fly   461 KDAKFESFRDLKGARACLPSFEGAAHLSVQET---------IVNATGKVQSLHSYF--------- 507
            |.|...::.:|||.::|        |.:|..|         :.|   |:.  |..|         
Human   453 KSASDLTWDNLKGKKSC--------HTAVGRTAGWNIPMGLLYN---KIN--HCRFDEFFSEGCA 504

  Fly   508 ---HRDSCLWNLQSGRKCPL-------HYQGDEGALRCLSEGADVAFLSSDVYKKYVVGNLTSNW 562
               .:||.|..|..|....|       .|.|..||.|||.|..||||:......:...|.....|
Human   505 PGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVKHQTVPQNTGGKNPDPW 569

  Fly   563 LTPGNHKDFRVLCPYGGIEKRSNFEYCYLHWTTRGHLMTHNSSLTRRNE---IYNSLRDMDQLFG 624
            ....|.||:.:||..|..:....:..|:|   .|.   .:::.:||:::   ::..||....|||
Human   570 AKNLNEKDYELLCLDGTRKPVEEYANCHL---ARA---PNHAVVTRKDKEACVHKILRQQQHLFG 628

  Fly   625 RK----------YKSETRPFTLYGIFDKRNNVLFRDDTDGLLGLQELHRDNAKRVMEHIYDRYAN 679
            ..          ::|||:            ::||||||   :.|.:||..|.       |::|..
Human   629 SNVTDCSGNFCLFRSETK------------DLLFRDDT---VCLAKLHDRNT-------YEKYLG 671

  Fly   680 TQYYR 684
            .:|.:
Human   672 EEYVK 676

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 81/393 (21%)
PBP2_transferrin 369..681 CDD:270247 89/361 (25%)
TR_FER 370..656 CDD:214514 83/335 (25%)
TFNP_001054.2 PBP2_transferrin_N 24..346 CDD:270336 77/364 (21%)
PBP2_transferrin_C 358..682 CDD:270335 92/371 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KI0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S8250
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11485
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.