DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and tf

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_001027487.1 Gene:tf XenbaseID:XB-GENE-480506 Length:703 Species:Xenopus tropicalis

Alignment Length:768 Identity:177/769 (23%)
Similarity:295/769 (38%) Gaps:175/769 (23%)


  Fly    18 ISMCVAVQPPDDGKLRVCVVESRGVYRKTPKF---C-------PLLEAKSNIECVIGV--DRLDC 70
            :::|:|: ||.:.::|.| .:|:..:.|....   |       ..:|..|..||:..:  ||.|.
 Frog    14 LALCLAM-PPKEKQVRWC-AKSKSEFSKCRDLVNTCKNKEITLSCVEKSSTDECLTAIQNDRADA 76

  Fly    71 VRRIHKGTAHFGVLTSEDLVAARWASVEILVASELRSH-ESHFEYEIVAVVDNHANIHTVHDLRG 134
            : .:..|..:.|.|...:|        :.::|....|| |....|..|||| ..::..|..:||.
 Frog    77 I-CVDGGDVYKGSLQPYNL--------KPIMAENYGSHTEPDTCYYAVAVV-KKSSTFTFDELRD 131

  Fly   135 ARLCHPGYGLGNHWTEVLANYFEAAMVSKTCDPEMTVTEDRIASTAKYFGPSCKAGPWVPDPKQD 199
            .|.||.|.|....|..::....|..:: |...|:   ||....:.:|:|..||     ||..|: 
 Frog   132 KRSCHTGIGKTAGWNVIIGLLLEKQLL-KWEGPD---TESLEKAVSKFFKASC-----VPGAKE- 186

  Fly   200 RILKNRYPSLCEMC--YEPDSC--DQTDKHWGRRGALYCLTSGGGNVAWARLDDVRSHFGFSGIP 260
                   |.||:.|  .:...|  ...:.::...||..||....|:||:.:         .|.:|
 Frog   187 -------PKLCQQCAGKKEHKCARSNNEPYYNYAGAFKCLQDDKGDVAFVK---------HSTVP 235

  Fly   261 AQSNPSDFSYLCPDGHLQPLNASQPCVWVAKPWPVVAARRSHAAQVQRLVTGLNHDEPD------ 319
            .:.: .|:..||||...:|::..:.|.....|...|.| |:...:.:.::..|...:..      
 Frog   236 EELH-KDYELLCPDNTRKPISDYKNCNLAKVPAHSVLA-RARDDKSKDIIAFLQEAQKTKECKLF 298

  Fly   320 SWQNALLSLLETYHVFTVPLDNVI-------AIDDYLDQATAFQSAYSFPECNPPRSIVFCTTSI 377
            |.|:....|.:...|..|||...|       |:  |..:..|.:......:...|..:.:||.|.
 Frog   299 SSQHGKDLLFKDTAVSLVPLPPTIDGFLFLGAV--YYQEIHALKEGVKEDDLAAPSKVRWCTQSK 361

  Fly   378 IQHIKC-SWLQEASQVYGVQPNIQCVRTMDEQQCLDNTKFKETDVVLVDQEMRVKAQRDYNLVPL 441
            .:..|| .|    :.:.|  .:|:|......:.|:......:.|.|.:|......|.: ..|||:
 Frog   362 AEKTKCDDW----TTISG--GSIECTEAATAEDCILQILKGDADAVTLDGGYMYTAGQ-CGLVPV 419

  Fly   442 LYEFAADMHDR-------------YVTIALVHKDAKFESFRDLKGARACLPSFEGAAHLSVQET- 492
            :.|: .|:.|.             |..:|:..|..|. |:::|:|.:.|        |.:|..| 
 Frog   420 MGEY-YDLDDLTPCQRRSSQAKGVYYAVAIAKKGTKV-SWKNLRGVKTC--------HTAVGRTA 474

  Fly   493 --------IVNATGKVQSLHSYFHRDS-------------CLWN----LQSGRKCPLH----YQG 528
                    |.|.|... ...||.....             |:.:    |.|.:||...    |.|
 Frog   475 GWNIPVGLITNETNNC-DFASYVGESCAPGSDVKSNLCKLCIGDPAKPLDSAKKCSPSASEAYHG 538

  Fly   529 DEGALRCLSEGADVAFLSSDVYKKYVVGNLTSNWLTPGNHKDFRVLCPYGGIEKRSNFEYCYLHW 593
            ..||.|||.|..||.|.......:...|...:.|.......|:.:|||.|.....::|:.|.|  
 Frog   539 YSGAFRCLVEKGDVCFAKHTTVFENTDGKNPAAWAKDLKSDDYELLCPDGSRAPINDFKRCNL-- 601

  Fly   594 TTRGHLMTHNSSLT---RRNEIYNSLRDMDQLFGRK-YKSETRPFTLYGIFDKRN--NVLFRDDT 652
               ..:..| |.:|   :|..:...|.:...|:||| ::.:     ::.:|..::  ::||:|.|
 Frog   602 ---AEVPAH-SVVTLPGKRKPVVEILVNQQSLYGRKGFQKD-----IFQMFQSKDGKDLLFKDST 657

  Fly   653 DGLLGLQELHRDNAKRVM-EHIYDRY----------ANTQYYRNFDESGAMKS 694
            ..||.:.|      |..| |.:.|:|          :||       :||.:.|
 Frog   658 QCLLEISE------KTTMQEFLGDKYYTAVTSLNKCSNT-------KSGLLSS 697

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 84/365 (23%)
PBP2_transferrin 369..681 CDD:270247 86/373 (23%)
TR_FER 370..656 CDD:214514 77/336 (23%)
tfNP_001027487.1 PBP2_transferrin_N 26..340 CDD:270336 83/355 (23%)
TR_FER 27..341 CDD:214514 83/355 (23%)
Connecting region. {ECO:0000250} 341..350 0/9 (0%)
PBP2_transferrin_C 353..685 CDD:270335 84/367 (23%)
TR_FER 354..686 CDD:214514 84/367 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.880

Return to query results.
Submit another query.