DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and meltf

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:XP_009300716.1 Gene:meltf ZFINID:ZDB-GENE-050309-40 Length:724 Species:Danio rerio

Alignment Length:773 Identity:173/774 (22%)
Similarity:294/774 (38%) Gaps:170/774 (22%)


  Fly    14 SFLSISMCVAVQPPDDGKLRVCVVESRGVYRKTPKFCPLLEAKSN------IECVIGVDRLDCVR 72
            :|||:.:.:.........:|.||:.    ..:..|...:.:|.|:      ::||:...:.:|.:
Zfish     5 TFLSVLLALTHYVSGQSTIRWCVIS----VAEESKCKAMAQAFSSASVRPALKCVLAASKAECAQ 65

  Fly    73 RI--HKGTAHFGVLTSEDLVAARWASVEILVASELRSHESHFEYEIVAVVDNHANIHTVHDLRGA 135
            ::  .|....|.....:.....:.||.:| .|.|..|......|..||||........:::|:|.
Zfish    66 KLTQKKEVDAFSASAKDIYDIGKLASFKI-AAGESGSDGKGITYYGVAVVKKTNAAININNLKGK 129

  Fly   136 RLCHPGYGLGNHWTEVLANYFEAAMVS-KTCD-PEMTVTEDRIASTAKYFGPSCKAGPWVPDPKQ 198
            :.||.|......|...|....::.|:| ..|: |:         ..|.:|..||     :|..|.
Zfish   130 KSCHTGKNRTAGWNVPLGYLIDSGMMSVMGCNIPQ---------GVADFFNASC-----IPGAKD 180

  Fly   199 DRILKNRYPSLCEMCYEPDS----CDQTDK--HWGRRGALYCLTSGGGNVAWARLDDVRSHFGFS 257
            |.      .|||:.|....:    ||.::|  ::...||..||....|:||:.:...|..:....
Zfish   181 DP------ASLCQQCVGDRTGQFKCDPSNKELYYAYDGAFRCLVEDAGDVAFVKHTTVSENTDGK 239

  Fly   258 GIP-AQSNPS-DFSYLCPDGHLQPLNASQPCVWVAKPWPVVAARRSHAAQV--QRLVTGLNHDEP 318
            |.. ||...| |:..||.||...|:...:.|               |.|:|  :.:|.     .|
Zfish   240 GASWAQELQSKDYQLLCRDGTRSPVTDYEKC---------------HLARVPSRGIVI-----HP 284

  Fly   319 DSWQNALLSLLETYHVFTVPL---------------DNVIAIDDYLDQATAFQSA---------- 358
            |      ::....|::.|..|               :|::    :.|.:|.|..|          
Zfish   285 D------ITTSVVYNMLTEGLQKSGFSMFSSADFGGENLL----FSDTSTKFIQAGNENYKEWMG 339

  Fly   359 -----YSFPECNP---PRSIVFCTTSIIQHIKCSWLQEASQVYGVQPNIQCVRTMDEQQCLDNTK 415
                 ....:|:.   |..:.:|..|..:..||:.:..|.:...:.||||||.....:.|:...:
Zfish   340 RYYHILKAMDCSQSDIPSQLQWCVLSHGEQQKCADMAVAFKNKNLIPNIQCVYGASVEDCMKKIQ 404

  Fly   416 FKETDVVLVDQEMRVKAQRDYNLVPLLYE-FAADMHDR-YVTIALVHKDAK-FESFRDLKGARAC 477
            .||.|.:.:|......|.:.|.|:|.:.| :..|.... |..:|::.|..: .:.|.||||.|:|
Zfish   405 NKEADAITLDGGYIYTAGKSYGLIPAVGESYTGDSDGSIYYAVAVLRKSNRDIQRFSDLKGKRSC 469

  Fly   478 LPSFEGAA------HLSVQETIVN-ATGKVQSLHSYFHRDSCL---------WNL-------QSG 519
            ...:...|      .|.:::.|:. .|.:|......|...:|:         .||       .||
Zfish   470 HTGYGRTAGWNIPMGLLIEKGIIRPQTCQVAQAAGEFFESACVPGADQKDFPENLCKQCIGDSSG 534

  Fly   520 R-KCPLH---YQGDEGALRCLSEG-ADVAFLSSDVYKKYVVGNLTSNWLTPGNHKDFRVLCPYGG 579
            : ||...   |.|.:||.|||.|. .||||:......:...||.|..|....:.::|::||....
Zfish   535 QFKCVKGKDLYDGYDGAFRCLVENHGDVAFVKHSTVFQNTDGNNTDPWAVNLDSREFQLLCSQES 599

  Fly   580 IEKRSNFEYCYLHWTTRGHLMTHNSSL---TRRNEIYNSLRDMDQLFGRKYKSETRPFTLYGIFD 641
            ..:.:.|..|.|     ..:.:|...:   |..:.|:..|....:.||....|:      :.:||
Zfish   600 RAEVTQFTKCNL-----ARVPSHAVMIRPDTNHHIIFGLLDKAQRFFGVNSASD------FKMFD 653

  Fly   642 KR----NNVLFRDDTDGLLGLQELHRDNAKRVMEHIYDRYANTQYYRNFDESGAMKSS 695
            .:    ::::|:|.|..|:|:.|          ...|:.:....|   .|...||:.|
Zfish   654 SKAYEGSDLIFKDSTITLIGVGE----------RKTYEEWLGQSY---LDSLIAMECS 698

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 82/388 (21%)
PBP2_transferrin 369..681 CDD:270247 83/350 (24%)
TR_FER 370..656 CDD:214514 80/324 (25%)
meltfXP_009300716.1 PBP2_transferrin 22..343 CDD:270247 80/376 (21%)
TR_FER 23..349 CDD:214514 80/381 (21%)
Periplasmic_Binding_Protein_Type_2 358..689 CDD:304360 84/355 (24%)
TR_FER 360..689 CDD:214514 84/353 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KI0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11485
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.