DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and MELTF

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:XP_011511152.1 Gene:MELTF HGNCID:7037 Length:765 Species:Homo sapiens

Alignment Length:769 Identity:170/770 (22%)
Similarity:271/770 (35%) Gaps:168/770 (22%)


  Fly     3 WLTLILVGLFASFLSISMCVAVQPPDD--GKLRVCVVESRGVYRKTPKFCPLLEAKSNIECVIGV 65
            ||.|.|..:... :.:..|....|...  |.:.....|: |:             :.::.||.|.
Human     9 WLLLALRTVLGG-MEVRWCATSDPEQHKCGNMSEAFREA-GI-------------QPSLLCVRGT 58

  Fly    66 DRLDCVRRIHKGTAHFGVLTSEDLVAARWASVEIL----------------VASELRSHESHFEY 114
            ....||:                |:||:.|....|                |..|:...|....|
Human    59 SADHCVQ----------------LIAAQEADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSY 107

  Fly   115 EIVAVVDNHANIHTVHDLRGARLCHPGYGLGNHWTEVLANYFEAAMVS-KTCDPEMTVTEDRIAS 178
            ..||||...::: |:..|:|.:.||.|......|...:....|:..:| ..||....|::     
Human   108 YAVAVVRRSSHV-TIDTLKGVKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLKAVSD----- 166

  Fly   179 TAKYFGPSCKAGPWVPDPKQDRILKNRYPSLCEMCYEPDS----CDQT--DKHWGRRGALYCLTS 237
               |||.||..|.......:         |||.:|....|    ||::  ::::...||..||..
Human   167 ---YFGGSCVPGAGETSYSE---------SLCRLCRGDSSGEGVCDKSPLERYYDYSGAFRCLAE 219

  Fly   238 GGGNVAWARLDDVRSHFGFSGIPAQSN---PSDFSYLCPDGHLQPLNASQPCVWVAKPWPVVAAR 299
            |.|:||:.:...|..:.....:|:...   ..||..||.||....:...:.|.....|...|..|
Human   220 GAGDVAFVKHSTVLENTDGKTLPSWGQALLSQDFELLCRDGSRADVTEWRQCHLARVPAHAVVVR 284

  Fly   300 R-SHAAQVQRLVT---GLNHDEPDSWQNALLSLLETYH----VFTVPLDNVIAIDDYLDQATAFQ 356
            . :....:.||:.   .|...|..|:|   :...|.|.    :|......::.|      ||...
Human   285 ADTDGGLIFRLLNEGQRLFSHEGSSFQ---MFSSEAYGQKDLLFKDSTSELVPI------ATQTY 340

  Fly   357 SAYSFPE---------CNP---PRSIVFCTTSIIQHIKCSWLQEASQVYGVQPNIQCVRTMDEQQ 409
            .|:...|         |:|   |..:.:|..|..:..||..:..|.:...::|.||||.....|.
Human   341 EAWLGHEYLHAMKGLLCDPNRLPPYLRWCVLSTPEIQKCGDMAVAFRRQRLKPEIQCVSAKSPQH 405

  Fly   410 CLDNTKFKETDVVLVDQEMRVKAQRDYNLVPLLYEFAA--DMHDRYVTIALVHKDAKFE-SFRDL 471
            |::..:.::.|.|.:..|....|.:.|.|||...|..|  |..:.|..:|:|.:|:... :..:|
Human   406 CMERIQAEQVDAVTLSGEDIYTAGKTYGLVPAAGEHYAPEDSSNSYYVVAVVRRDSSHAFTLDEL 470

  Fly   472 KGARACLPSFEGAAHLSVQETIVNATGKVQ--------SLHSYFHRDS----------------C 512
            :|.|:|...|...|...|....:...|.::        ::..:|:...                |
Human   471 RGKRSCHAGFGSPAGWDVPVGALIQRGFIRPKDCDVLTAVSEFFNASCVPVNNPKNYPSSLCALC 535

  Fly   513 LWNLQSGRKC----PLHYQGDEGALRCLSEGA-DVAFLSSDVYKKYVVGNLTSNWLTPGNHKDFR 572
            :.:.|...||    ...|.|..||.|||.|.| ||||:..........|:.:..|......:|:.
Human   536 VGDEQGRNKCVGNSQERYYGYRGAFRCLVENAGDVAFVRHTTVFDNTNGHNSEPWAAELRSEDYE 600

  Fly   573 VLCPYGGIEKRSNFEYCYLHWTTRGHLMTHNSSLTRRNEIYNSLRDMDQLFGRKYKSETRPFTLY 637
            :|||.|...:.|.|..|.|.......:|.                          :.:|..||:|
Human   601 LLCPNGARAEVSQFAACNLAQIPPHAVMV--------------------------RPDTNIFTVY 639

  Fly   638 GIFDKRNNVLFRDDTDGLLGLQELHRDN--AKRVMEHIYDRYANTQYYRNFDES 689
            |:.||...  |.....|.:.|.|...:.  ..|..:.::....|...::.||.|
Human   640 GLLDKAQQ--FAASGTGRVTLPEPSEEQVVCLRCFQDLFGDDHNKNGFKMFDSS 691

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 82/381 (22%)
PBP2_transferrin 369..681 CDD:270247 78/346 (23%)
TR_FER 370..656 CDD:214514 74/318 (23%)
MELTFXP_011511152.1 Transferrin 23..357 CDD:278817 82/391 (21%)
PBP2_transferrin 23..355 CDD:270247 82/389 (21%)
TR_FER 367..733 CDD:214514 81/354 (23%)
PBP2_transferrin 367..731 CDD:270247 81/354 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KI0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11485
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.