DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and LTF

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_002334.2 Gene:LTF HGNCID:6720 Length:710 Species:Homo sapiens

Alignment Length:778 Identity:181/779 (23%)
Similarity:279/779 (36%) Gaps:194/779 (25%)


  Fly     3 WLTLILVGLFASFL-----SISMCVAVQPPDDGKLRVCVVESRGV--YRKTPKFCPLLEAKSNIE 60
            :|.|:.:|.....|     |:..| ||..|:..|   |....|.:  .|..|..|  ::..|.|:
Human     5 FLVLLFLGALGLCLAGRRRSVQWC-AVSQPEATK---CFQWQRNMRKVRGPPVSC--IKRDSPIQ 63

  Fly    61 CV--IGVDRLDCVRRIHKGTAHFGVLTSEDLVAARWASVEILVASELRSHESHFEYEIVAVVDNH 123
            |:  |..:|.|.|      |...|.:....|...:...|...|....|...:|  |..||||...
Human    64 CIQAIAENRADAV------TLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTH--YYAVAVVKKG 120

  Fly   124 ANIHTVHDLRGARLCHPGYGLGNHWTEVLANYFEAAMVSKTCDPEMTVT---EDRIASTAKYFGP 185
            .:.. :::|:|.:.||.|......|...:.          |..|.:..|   |...|:.|::|..
Human   121 GSFQ-LNELQGLKSCHTGLRRTAGWNVPIG----------TLRPFLNWTGPPEPIEAAVARFFSA 174

  Fly   186 SCKAGPWVPDPKQDRILKNRYPSLCEMC--YEPDSC--DQTDKHWGRRGALYCLTSGGGNVAWAR 246
            ||.       |..|   |.::|:||.:|  ...:.|  ...:.::...||..||..|.|:||:.|
Human   175 SCV-------PGAD---KGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIR 229

  Fly   247 LDDVRSHFGFSGIPAQSNPSDFSYLCPDGHLQPLNASQPCVWVAKPWPVVAARRSHAAQVQRLVT 311
            ...|     |..:..::...::..||||...:|::..:.|.....|        |||. |.|.|.
Human   230 ESTV-----FEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVP--------SHAV-VARSVN 280

  Fly   312 GLNHDEPDSWQNALLSLLE--------TYHVFTVP--------LDNVIA-------IDD--YLDQ 351
            |    :.|:..|.|....|        .:.:|..|        .|:.|.       ||.  ||..
Human   281 G----KEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGS 341

  Fly   352 A--TAFQSAYSFPECNPPR--SIVFCTTSIIQHIKCS-W--LQEASQVYGVQPNIQCVRTMDEQQ 409
            .  ||.|:.....|....|  .:|:|.....:..||: |  |.|.|        :.|......:.
Human   342 GYFTAIQNLRKSEEEVAARRARVVWCAVGEQELRKCNQWSGLSEGS--------VTCSSASTTED 398

  Fly   410 CLDNTKFKETDVVLVDQEMRVKAQRDYNLVPLLYEFAADMH---------DR----YVTIALVHK 461
            |:......|.|.:.:|......|.: ..|||:|.|......         ||    |:.:|:|.:
Human   399 CIALVLKGEADAMSLDGGYVYTAGK-CGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRR 462

  Fly   462 DAKFESFRDLKGARACLPSFEGAAHLSVQET---------IVNATGKVQSLHSYFHRDS------ 511
            .....::..:||.::|        |.:|..|         :.|.||..: ...||.:..      
Human   463 SDTSLTWNSVKGKKSC--------HTAVDRTAGWNIPMGLLFNQTGSCK-FDEYFSQSCAPGSDP 518

  Fly   512 -------CLWNLQSGRKCPLH----YQGDEGALRCLSEGA-DVAFLSSDVYKKYVVGNLTSNWLT 564
                   |:.:.|...||..:    |.|..||.|||:|.| ||||:......:...||....|..
Human   519 RSNLCALCIGDEQGENKCVPNSNERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAK 583

  Fly   565 PGNHKDFRVLCPYGGIEKRSNFEYCYLHWTTRGHLMTHNSSLTRRNEIYNSLRDMDQLFGRK--- 626
            .....||.:||..|..:..:....|:|.......:::....:.|..::   |......|||.   
Human   584 DLKLADFALLCLDGKRKPVTEARSCHLAMAPNHAVVSRMDKVERLKQV---LLHQQAKFGRNGSD 645

  Fly   627 -------YKSETRPFTLYGIFDKRNNVLFRDDTDGLLGLQELHRDNAKRVMEHIYDRYANTQY 682
                   ::|||:            |:||.|:|:   .|..||....       |::|...||
Human   646 CPDKFCLFQSETK------------NLLFNDNTE---CLARLHGKTT-------YEKYLGPQY 686

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 88/373 (24%)
PBP2_transferrin 369..681 CDD:270247 80/365 (22%)
TR_FER 370..656 CDD:214514 75/339 (22%)
LTFNP_002334.2 Bactericidal and antifungal activity 20..29 2/10 (20%)
Critical for glycosaminoglycan, lipid A, lysozyme and DNA binding 20..24 0/4 (0%)
Important for full bactericidal and antifungal activities 21..22 0/1 (0%)
PBP2_transferrin_N 24..351 CDD:270336 93/380 (24%)
Transferrin 25..352 CDD:278817 92/380 (24%)
Bactericidal and antifungal activity 39..49 1/10 (10%)
Interaction with lipopolysaccharide 39..49 1/10 (10%)
Interaction with pspA 39..46 1/7 (14%)
Involved in glycosaminoglycan binding 46..51 1/5 (20%)
Interaction with pspA 57..58 0/1 (0%)
PBP2_transferrin_C 361..694 CDD:270335 82/370 (22%)
TR_FER 364..695 CDD:214514 82/367 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KI0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11485
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.