DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and Tsf2

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_524044.1 Gene:Tsf2 FlyBaseID:FBgn0036299 Length:819 Species:Drosophila melanogaster

Alignment Length:817 Identity:170/818 (21%)
Similarity:291/818 (36%) Gaps:198/818 (24%)


  Fly    32 LRVCVVESRGVYRKTPKFCPLLEAKSNIECVIGVDRLDCVRRIHKGTAHFGVLTSEDL-VAARWA 95
            |.|.:...|.::.         |...|:.|.:.....:|:..|.:..||...|.:.|: .|.|:.
  Fly    49 LTVAIERDRALFD---------EVFLNLTCFMAYSADECIHHIDREKAHITTLDAGDVFTAGRYN 104

  Fly    96 SVEILVASELRSHESHF-EYEIVAVVDNHA--NIHTVHDLRGARLCHPGYGLGNHWTEVLANYF- 156
            |:..::..:|   |..| :|:.|||:...:  :::.:.|:|..|:|.|       |...||.:. 
  Fly   105 SLIPIMQEKL---EGGFADYQSVAVIKKGSLPDLNNLRDMRNKRVCFP-------WVGSLAGWIV 159

  Fly   157 -------EAAMVSKTCDPEMTVTEDRIASTAKYFGPSCKAGPWVPDPKQDRILKNRYPSLCEMC- 213
                   |..|....|:       :::.:.|.||..||..  :....|.:.|..|. ..||.:| 
  Fly   160 PIHTLQREGGMEVVDCN-------NQVKTAASYFNNSCAV--YSLSDKHNPIGDNS-DKLCTLCT 214

  Fly   214 --YEPDSCDQTDKHWGRRGALYCLTSGGGNVAWAR---LDDVRSHFGFSGIPAQSNPSDFSYLCP 273
              .....|...|.::|..||..||.. .|:||:.|   ::::.....|..|.    |..|..||.
  Fly   215 GKIPGGRCSSADPYFGYEGAFKCLLE-KGDVAFLRHSTVNEMLQTTEFKNIA----PDTFELLCR 274

  Fly   274 DGHLQPLNASQPCVWVAKPWPVVAA--------RRSHAAQVQRLV----TGLNHDEP-------- 318
            ||....:|..:.|.|...|...:..        |:.:...::|:.    .|...|:.        
  Fly   275 DGRRASINDYRQCNWGQVPADAIVTSSARSFSDRKQYQQFLKRIAELYSDGTRDDQSRQGGQSFN 339

  Fly   319 --------------------------DSWQNALLS-----------------LLETYHVF----- 335
                                      |.:::..|.                 |.|.:.:|     
  Fly   340 SRNNINDQNAYGQFDNNDPYRTQNQYDQYRSERLDSSFAEERNQQDGTNTSILYEKFRIFESKRY 404

  Fly   336 ---------------TVPLDNVIAIDDYLDQATAFQSAYSFPECNPPRSIVFCTTSIIQHIKCSW 385
                           .:|.|:. :...||..|..|  .|...|| |..::..|.||..:..||..
  Fly   405 GKPNLLFQDSSRALTVIPEDDQ-SFTKYLGPAINF--IYGIREC-PVPAMTLCVTSENELDKCIK 465

  Fly   386 LQEASQVYGVQPNIQCVRTMDEQQCLDNTKFKETDVVLVDQEMRVKAQRDYNLVPLLYEFAADMH 450
            ::.|.:.:.::|.:.|.:......|:...:..:.|:.:.|.........:|:|||.:.|......
  Fly   466 MRTALKAHLLKPELICKKMHSHINCMQFIEAGKADISVFDAGDVYTGGLNYDLVPFMSEVYNLGE 530

  Fly   451 DRYVTIALVHKDAKFESFRDLKGARACLPSFEGAAHLSVQETIVNATG--------KVQSLHSYF 507
            ..|..:|:..:|........|||...|......||..:....:..:.|        .|::...||
  Fly   531 PEYYVVAVAKEDDPDTELTYLKGKNTCHTGINTAAGWTYPMALFISNGWIRPYGCDSVRAAAEYF 595

  Fly   508 HRDSCLWNLQSGR---------KCPL---------------HYQGDEGALRCLSE-GADVAFLSS 547
            .: ||:....|..         .|.|               .|.|..||.|||.| |..|||:..
  Fly   596 TK-SCVPGAISNEYNTGVPYDSMCDLCHGTSYRYCRRDASEEYYGHTGAFRCLVEGGGHVAFMKH 659

  Fly   548 DVYKKYVVGNLTSNWLTPGNHKDFRVLCPYGGIEKRSNFEYCYLHWTTRGHLMTH---NSSLTRR 609
            ....:...|.....|.....:.||.:||..|...:..:::.|.|.......::|.   |.:.|:.
  Fly   660 TTVMESTGGKRKEWWARNALNDDFELLCTDGTRAEIQDYKRCNLGKVKANAVVTRGGVNYNETQM 724

  Fly   610 NEIYNSLRDMDQLFGRKYKSETRPFTLY----GIFDKRNNVLFRDDTDGLLGLQELHRDNAKRVM 670
            |...|.|....||:||| :.:...|:::    |.:|    ::|:|.|..|    ::...|.:|  
  Fly   725 NAYINLLTYAQQLYGRK-EVDAFSFSMFSSPIGHYD----LIFQDATRQL----QVIPPNKRR-- 778

  Fly   671 EHIYDRYANTQYYR----NFDESGAMKSSHNLWILLV 703
               ||.|..:.:.|    ....:||.:.:.::.:|||
  Fly   779 ---YDAYLGSDFMRARRITDCYAGASQLALSVGLLLV 812

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 85/436 (19%)
PBP2_transferrin 369..681 CDD:270247 78/352 (22%)
TR_FER 370..656 CDD:214514 73/326 (22%)
Tsf2NP_524044.1 PBP2_transferrin 32..372 CDD:270247 72/357 (20%)
PBP2_transferrin 450..792 CDD:270247 79/357 (22%)
TR_FER 452..790 CDD:214514 79/353 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KI0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125278at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11485
RoundUp 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.