DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and Tsf1

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_001285404.1 Gene:Tsf1 FlyBaseID:FBgn0022355 Length:641 Species:Drosophila melanogaster

Alignment Length:714 Identity:176/715 (25%)
Similarity:300/715 (42%) Gaps:128/715 (18%)


  Fly     3 WLTLILVGLFASFLSISMCVAVQPPDDGKLRVCVVESRGVYRKTPKFCPLL-----EAKSNIECV 62
            ||.|.:..|.. .|.....:|.:|    ..|:||.:   :|...   |..|     ||...:|||
  Fly    10 WLPLAVAALLL-ILGPQSSLAEEP----IYRLCVPQ---IYLAE---CQQLLADPSEAGIRMECV 63

  Fly    63 IGVDRLDCVRRIHKGTAHFGVLTSEDL-VAARWASVEILVASELRSH---ESHFEYEIVAVVDNH 123
            .|.||:||:..|.:..|.......||: :|....:.:..|.||:|:.   ::.|.||.:.:|...
  Fly    64 AGRDRVDCLELIEQRKADVLATEPEDMYIAYHRKNEDYRVISEIRTQQDKDAAFRYEGIILVKKD 128

  Fly   124 ANIHTVHDLRGARLCHPGYGLGNHWTEVLANYFEAAMVSKTCDPEMTVTEDRIASTAKYFGPSCK 188
            :.|.|:..||||:.||.|:|....:...:.......::..:.||:::.||..:.|.:::|..||.
  Fly   129 SPIRTLQQLRGAKSCHTGFGRNVGYKIPITKLKNTHVLKVSADPQISATERELKSLSEFFTQSCL 193

  Fly   189 AGPWVPDPKQDRILKNRYPSLCEMCYEPDSCDQTDKHWGRRGALYCLTSGGGNVAWARLDDVRSH 253
            .|.:...|:.||:||.:|.:||.:|.:|:.|:..||..|..||:.||..|.|.||::::..::.:
  Fly   194 VGTYSTHPETDRLLKKKYANLCALCEKPEQCNYPDKFSGYDGAIRCLDKGQGEVAFSKVQYIKKY 258

  Fly   254 FGFSGI-----PAQSNPSDFSYLCPDGHLQPLNASQPCVWVAKPW--------PVVAARRSHAAQ 305
            ||..|.     ||:.||.:|.|||.||..:|: ....|.|..:||        .|..:.:.|..|
  Fly   259 FGLPGAGPDAPPAEGNPENFEYLCEDGTRRPV-TGPACSWAQRPWSGYISNEQAVHNSEQLHQLQ 322

  Fly   306 --VQR-LVTGLNHDEPDSWQNALLSLLETYHVFTVPLDNVIAID--DYLDQATAFQSAYSFPECN 365
              ::| ...||.....|:..:.|:.....||.....:|..:.::  .|.|......||.      
  Fly   323 SRLERFFANGLQAQNKDAAAHLLIQPNAVYHSKDAAIDPKVYLERAGYKDVIERDGSAI------ 381

  Fly   366 PPRSIVFCTTSIIQHIKCSWLQEASQVYGVQPNIQCVRTMDEQQCLDNTKFKETDVVLVDQEMRV 430
              |.|..|..:..:..||..|.:|:.....:|.::||::.|   |:.....||.|:.:|......
  Fly   382 --RKIRLCAQNDDEFAKCQALHQAAYARDARPELECVQSTD---CVVALTKKEADLTIVRATGYA 441

  Fly   431 KAQRDYNLVPLLYEFAADMHDRYVTIAL--VHKDAKFESFRDLKGARACLPSFEGAAHLSVQETI 493
            .| |...|.|::||..| ..|..|.:|.  |.::|..::  .:|....|..|...||.|:.:..:
  Fly   442 DA-RSNQLQPIVYEQRA-QDDVLVAVAAPGVTREALQKA--SIKFNENCERSRAAAALLNKRRGL 502

  Fly   494 VNATGKVQSLHSYFHRDSCLWNLQSGRKCPLHYQGDEGALRCLSEGADVAFLSSDVYKKYVVGNL 558
                            |:|..:           ..|:|.::.:.        :|::.|       
  Fly   503 ----------------DACRVS-----------SSDDGEVQIVP--------ASELEK------- 525

  Fly   559 TSNWLTPGNHKDFRVLCPYGGIEKR--SNFEYCYLH-WTTRGHLMTHNSSLTRRNEIYNSLRDMD 620
                     |||.:::||  .:|:|  ::|..|.:. ...|...:..:::...:..:.:....:.
  Fly   526 ---------HKDAQLVCP--SLERRPVTDFRDCNVDVQLPRAIFIRSDTTSVEQETVKHLFSLIS 579

  Fly   621 QLFGRKYKSETRPFTLYGIFDK-RNNVLFRDDTDGLLGLQELHRDNAKRVMEHIYDRYANTQYY 683
            ..||.:.|. ...|.|:|.|.| :.||.|              .|.|.::...:.:...|.|.|
  Fly   580 DKFGARGKL-VDVFALFGEFQKGKKNVYF--------------NDKAVQLTTELKNEIQNEQIY 628

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 103/362 (28%)
PBP2_transferrin 369..681 CDD:270247 63/318 (20%)
TR_FER 370..656 CDD:214514 60/292 (21%)
Tsf1NP_001285404.1 PBP2_transferrin 34..>302 CDD:270247 87/275 (32%)
Periplasmic_Binding_Protein_Type_2 384..615 CDD:304360 62/306 (20%)
TR_FER 384..614 CDD:214514 62/305 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KI0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125278at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11485
RoundUp 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.