DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and RGD1310507

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_001041356.1 Gene:RGD1310507 RGDID:1310507 Length:462 Species:Rattus norvegicus

Alignment Length:501 Identity:115/502 (23%)
Similarity:184/502 (37%) Gaps:113/502 (23%)


  Fly   259 IPAQSNPSDFSYLCPDGHLQPLNASQPCVWVAKPWPVVAARRSHAAQVQRLVTGLNHDEPDSWQN 323
            :|.:::...:..||||...:|::..:.|.....|..||.||.         |.|    :.||.|.
  Rat     1 MPRKADRDQYELLCPDNTRRPVDEYEQCYLARVPSHVVVARS---------VDG----KEDSIQE 52

  Fly   324 ALLSLLE--------TYHVFTVPLDNVIAIDD----------------YL--DQATAFQSAYSFP 362
            .|....|        |:.:|..|....:...|                ||  :..:|.::.....
  Rat    53 LLRVAQEHFGKDKSSTFQLFGSPHGKDLLFTDAACGLLRVPPKMDIGLYLGYELLSAIRNLKRGS 117

  Fly   363 ECNPPRSIVFCTTSIIQHIKCS-WLQEASQVYGVQPNIQCVRTMDEQQCLDNTKFKETDVVLVDQ 426
            |  ..|.:.:|.....:..||. |    |.|.|  ..:.|......:.|:......|.|.|.:|.
  Rat   118 E--DSRRVKWCAVGQQERAKCDHW----SAVSG--GALACATEERREDCIAAVMKGEADAVNLDG 174

  Fly   427 EMRVKAQRDYNLVPLLYEFAADMH--------------DRYVTIALVHKDAKFESFRDLKGARAC 477
            .....|.. ..|||.|.|.....|              :.|..:|:|.|.....::..|:|.::|
  Rat   175 GFAYIAGH-CGLVPGLGENYLSPHSSERLGSKCVNAALEGYYVVAVVKKSDVGITWNSLQGKKSC 238

  Fly   478 LPSFEGAAHLSVQETIV-NATGKVQ--------SLHS--YF--------HRDSCLWNLQSGRKCP 523
            ..:...:|..:|..::: |.||..:        |.|:  :|        :.||.|..|.:|...|
  Rat   239 HTAVGTSAGWNVPMSLIYNQTGSCKFGRTDSGLSFHADEFFSGGCAPGANPDSRLCALCAGGNEP 303

  Fly   524 LH---------YQGDEGALRCLSEGADVAFLSSDVYKKYVVGNLTSNWLTPGNHKDFRVLCPYGG 579
            .|         |.|..||||||.|..||||:......:...|....:|.....|:||.:||..|.
  Rat   304 AHMCAANNDEGYHGSSGALRCLVEKGDVAFMKHPTVLQNTDGKNPESWAKGLKHEDFELLCLDGT 368

  Fly   580 IEKRSNFEYCYLHWTTRGHLMTHNSSLTRRNE---IYNSLRDMDQLFGRKYKSETRPFTLYGIFD 641
            .:..:..:.|:|      ..:.:::..:|:::   :...|.:..:||||. ..|.|.|.::.  .
  Rat   369 RKPVTEAQNCHL------DRVPNHAVFSRKDKVDFVQRMLFNQQELFGRN-GFEYRMFQMFE--S 424

  Fly   642 KRNNVLFRDDTDGLLGLQELHRDNAKRVMEHIYDRYANTQYYRNFD 687
            ...::||.|||:.|..||.          :..|..|...||....|
  Rat   425 SHKDLLFSDDTECLSNLQN----------KATYKTYLGPQYLTLMD 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 27/135 (20%)
PBP2_transferrin 369..681 CDD:270247 84/358 (23%)
TR_FER 370..656 CDD:214514 80/332 (24%)
RGD1310507NP_001041356.1 Periplasmic_Binding_Protein_Type_2 <1..114 CDD:304360 26/126 (21%)
PBP2_transferrin_C 120..462 CDD:270335 88/368 (24%)
TR_FER 123..461 CDD:214514 87/365 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KI0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11485
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.