DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and tfa

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_001278428.1 Gene:tfa ZFINID:ZDB-GENE-980526-35 Length:673 Species:Danio rerio

Alignment Length:736 Identity:168/737 (23%)
Similarity:285/737 (39%) Gaps:155/737 (21%)


  Fly    16 LSISMCVAVQPPD---DGKLRVCVVESRGVYRKTPKFCPLLEAK-SNIECVIGVDRLDCVRRIHK 76
            :|:..|:.|..|.   ..|::.||..     :.....|..|..| ::|||.:....:||:|.|..
Zfish     6 ISLLGCLVVALPSASAQKKVKWCVTT-----QNEQSKCRHLATKAADIECHLQPTVIDCMRSIAA 65

  Fly    77 GTAHFGVLTSEDLVAARWASV------EILVASELRSHESHFEYEIVAVVDNHANIHTVHDLRGA 135
            |        ..|:|....|:|      ..|:...:...:....|.:.||  ...:...:::|:|.
Zfish    66 G--------GTDIVTVDGANVFTGGLNNYLLRPIIAEKKKECCYAVAAV--KAGSGFNINELKGK 120

  Fly   136 RLCHPGYGLGNHWTEVLANYFEAAMVSKTCDPEMTVTEDRIASTAKYFGPSCKAGPWVPDPKQDR 200
            ..||..|.....|...:........::.....||.|..    :.:::|..||..|          
Zfish   121 SSCHSCYQRSGGWNTPIGKLIATNKITWEGPNEMPVER----AVSEFFSSSCVPG---------- 171

  Fly   201 ILKNRYPSLCEMCYEPDSCDQTDKHWGRRGALYCLTSGGGNVAWARLDDVRSHFGFSGIPAQSNP 265
            :.|.:||:||:.|....||...:|::|..||..||.:..|.||:     |..|    .|| :|..
Zfish   172 VSKPKYPNLCKACQGDCSCSHNEKYFGDDGAFQCLKNDNGQVAF-----VCHH----AIP-ESER 226

  Fly   266 SDFSYLCPDGHLQPLNASQPCVWVAKPWPVVAARRSHAAQV------QRLVTGLNHDEPDSWQNA 324
            .::..||.||..:.:...:.|.:..:|...|.||.....|.      |...:.|...:....::.
Zfish   227 QNYELLCMDGSRKSVEDYKTCNFAREPARTVIARTDTDLQYVYDVLKQIPASDLFSSQAFGGKDL 291

  Fly   325 LLSLLETYHVFTVP--LDNVIAI-DDYLDQATAFQSAYSFPECNP--PRS---IVFCTTSIIQHI 381
            :.|...| .:..:|  .|:::.: ::|      :::..:|.:.||  |.|   :..||....:..
Zfish   292 IFSDSAT-ELMLLPKRTDSLLYLKEEY------YEAMQAFKDGNPSAPTSQTKLAMCTIGHAEKN 349

  Fly   382 KCSWLQEASQVYGVQPNIQCVRTMDEQQCLDNTKFKETDVVLVDQEMRVKAQRDYNLVPLLYEFA 446
            ||..|....:        .|:.......|::..|.||.|.:.||.. :|.......|||::.|.:
Zfish   350 KCDSLDHVKK--------SCILEASVDDCIEKIKRKEADFLAVDGG-QVYIAGKCGLVPVMAEQS 405

  Fly   447 ADMH--------DRYVTIALVHKDAKFESFRDLKGARACLPSFEGAAHLSVQETIVNATGKVQSL 503
            ....        ..|..:|:|.|.:.. ::.:|:|.::|......:|...:.|:.:.......:|
Zfish   406 NSQSCSSGSGGTASYYAVAVVRKGSGL-TWNNLEGKKSCHTGLGRSAGWKIPESAICGEKDKCTL 469

  Fly   504 HSYFHR----------DSCLWNLQSGR------KC----PLHYQGDEGALRCLSEGA-DVAFLSS 547
            ..:|..          :.|.....||:      ||    ...|.|.:||.|||:|.| ||||:  
Zfish   470 DKFFSEGCAPGADPTSNMCKLCKGSGKPVGDESKCKPSAEEQYYGYDGAFRCLAEKAGDVAFI-- 532

  Fly   548 DVYKKYVVGNLT----SNWLTPGNHKDFRVLCPY--GGIEKRSNFEYCYLHWTTRGHLMTHNSSL 606
               |..|||:.|    .:|......:||.::||.  ....|.::||.|.|     ..:..| :.:
Zfish   533 ---KHTVVGDYTDGKGKDWAKDLKSEDFELICPNTPDTTMKYTDFEKCNL-----AQVPVH-AVI 588

  Fly   607 TR---RNEIYNSLRDM----DQLFGRKYKSETRPFTLYGIFDKRNNVLFRDDTDGLLGLQELHR- 663
            ||   |:.:.:.|.|:    :.||..|               ...|:||   |||...|||:.. 
Zfish   589 TREDARSAVVSFLSDIQSKNNDLFTSK---------------DGKNLLF---TDGTKCLQEIKGS 635

  Fly   664 -DN--AKRVMEHIYDRYANTQ 681
             |:  .|:.::.|...|..:|
Zfish   636 VDDFLTKKYIDMIERTYKTSQ 656

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 77/353 (22%)
PBP2_transferrin 369..681 CDD:270247 85/361 (24%)
TR_FER 370..656 CDD:214514 77/328 (23%)
tfaNP_001278428.1 Periplasmic_Binding_Protein_Type_2 25..325 CDD:304360 74/346 (21%)
TR_FER 25..322 CDD:214514 73/343 (21%)
Periplasmic_Binding_Protein_Type_2 336..648 CDD:304360 82/351 (23%)
TR_FER 341..653 CDD:214514 84/351 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KI0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11485
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.