DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and Ltf

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_001100334.1 Gene:Ltf RGDID:1305445 Length:709 Species:Rattus norvegicus

Alignment Length:780 Identity:167/781 (21%)
Similarity:283/781 (36%) Gaps:212/781 (27%)


  Fly    15 FLSISMCVAVQPP----DDGKLRVCVVESRGVYRKTPKFCPLLEAKSNIECVIGVDRLDCVRRIH 75
            |:::.|.:.|..|    .|..:|.|.: ||...:|    |.:.:...|   ..||.:|.|.|:  
  Rat     4 FITVLMFLGVLGPFLARIDTVVRWCTI-SRNEAQK----CFMWQEMLN---KAGVPKLRCARK-- 58

  Fly    76 KGTAHFGVLTSEDLVAARWASVEIL---------------VASEL--RSHESHFEYEIVAVVDNH 123
                :|.....::::..|..::.:.               :|:|:  ...:....|..||||.|.
  Rat    59 ----YFMPHCIQEIMMRRADAMTLSGSAIFDFYFPYKLQPIAAEVYGTKEKPRIHYYAVAVVKNS 119

  Fly   124 ANIHTVHDLRGARLCHPGYGLGNHWTEVLANYFEAAMVSKTCDPEMTVTEDRIA---STAKYFGP 185
            ::|. ::.|:|.:.||.|:.....|...|.          ...|.:...|..::   :.:|:|..
  Rat   120 SDIR-LNQLQGLKSCHAGFDTSAGWIAPLG----------ALRPYLNWDEKSVSLEEAVSKFFSQ 173

  Fly   186 SCKAGPWVPDPKQDRILKNRYPSLCEMCYEPDS--CD--QTDKHWGRRGALYCLTSGGGNVAWAR 246
            ||..|          |.|:|:|.||.:|.....  ||  ..:.:.|..||..||....|:||:.|
  Rat   174 SCVPG----------ISKSRFPRLCSLCAGKGEHICDFSPQEPYAGYAGAFRCLRDNAGDVAFIR 228

  Fly   247 LDDVRSHFGFSGIPAQSNPSDFSYLCPDGHLQPLNASQPCVWVAKPWPVVAARRSHAAQV-QRLV 310
            ...:     |..:|.::....:..||||...:|:...:.|               |.||: .|.|
  Rat   229 ESTI-----FEELPNEAEWDQYKLLCPDNTWKPVTEYKEC---------------HLAQIPSRAV 273

  Fly   311 TGLNHDEPDS--WQNALLSLLE---------TYHVFTVPL--------DNVI-------AIDDYL 349
            ......|.||  |:  ||.|.:         .:.:|...|        |:||       .::.:|
  Rat   274 VAHVRSEKDSAIWE--LLHLSQEMFGKNKTSKFELFGSYLGQKDLLFKDSVIGFVRVPFTVNVWL 336

  Fly   350 DQATAFQSAY-SFPECNP-----PRSIVFCTTSIIQHIKCSWLQEASQVYGVQPNIQCVRTMDEQ 408
            ....::..|. |..|...     ...|.:|.....:.:||......|     ...|.|:.....:
  Rat   337 YLTFSYIMALKSLKESKENVMALRARITWCAVGSEEKLKCDQWSRVS-----VGKITCISCTTTE 396

  Fly   409 QCLDNTKFKETDVVLVDQEMRVKAQRDYNLVPLLYEF-------AADMHDR----YVTIALVHKD 462
            ||:.:....:.|.:.:|......|.: ..|||:|.|.       .:|..||    |:.:|.|.|:
  Rat   397 QCIFSITMGDADAMNLDGGYIYSAGK-CGLVPVLAEIQKSPNSNGSDCVDRPAEGYLAVAAVRKE 460

  Fly   463 AKFESFRDLKGARACLPSFEGAAHLSVQET---------IVNATGKVQSLHSYFHRDS------- 511
            ....::..::|.::|        |.:|..|         :||.|...| ...:|::..       
  Rat   461 DTGFTWSTVRGKKSC--------HTAVDRTAGWNIPMGLLVNQTNSCQ-FKEFFNKSCAPGSFLY 516

  Fly   512 ------CLWNLQSGRKC----PLHYQGDEGALRCLSEGA-DVAFLSSDVYKKYVVGNLTSNWLTP 565
                  |:.:.....||    ...|||..||.|||:|.| :||||......:...|.....|...
  Rat   517 SNLCALCIGDENGKDKCNPNSQERYQGYVGAFRCLAEKAGNVAFLKDATVLQNTDGKNADKWAKN 581

  Fly   566 GNHKDFRVLCPYGGIEKRSNFEYCYLHWTTRGHLMT---HNSSLTRRNEIYNSLRDMDQLFGRK- 626
            ....||.:||.....:..:..:.|:|. ....|.:.   ..:.|.::..:|..::     |||. 
  Rat   582 LKLDDFELLCLDDTRKPVTEAKNCHLA-VAPNHAVVARKDKARLVQQELLYQQVQ-----FGRNG 640

  Fly   627 ---------YKSETRPFTLYGIFDKRNNVLFRDDTDGLLGLQELHRDNAKRVMEHIYDRYANTQY 682
                     ::|||:            |:||.|:|:.|          ||...:..::.|...:|
  Rat   641 CRCPEEFCLFRSETK------------NLLFNDNTECL----------AKLPSKITWEEYLGKEY 683

  Fly   683  682
              Rat   684  683

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 84/392 (21%)
PBP2_transferrin 369..681 CDD:270247 77/363 (21%)
TR_FER 370..656 CDD:214514 74/337 (22%)
LtfNP_001100334.1 Periplasmic_Binding_Protein_Type_2 24..350 CDD:304360 83/383 (22%)
Transferrin 25..351 CDD:278817 83/383 (22%)
PBP2_transferrin_C 360..691 CDD:270335 78/368 (21%)
TR_FER 363..692 CDD:214514 78/365 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KI0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11485
Phylome 1 0.910 0.857 Consistency score
TreeFam 1 0.960
54.880

Return to query results.
Submit another query.