DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and Meltf

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:XP_006522295.1 Gene:Meltf MGIID:1353421 Length:758 Species:Mus musculus

Alignment Length:752 Identity:164/753 (22%)
Similarity:273/753 (36%) Gaps:184/753 (24%)


  Fly    34 VCVVESRGVYRKTPKFCPLLEA-----------------KSNIECVIGVDRLDCVRRIHKGTAHF 81
            |||:|        .::|.:.:|                 :.::.||.|.....||:.|.:..|..
Mouse    18 VCVME--------VQWCTISDAEQQKCKDMSEAFQGAGIRPSLLCVQGNSADHCVQLIKEQKADA 74

  Fly    82 GVLTSEDLVAARWASVEILVASELRSHESHFEYEIVAVVDNHANIHTVHDLRGARLCHPGYGLGN 146
            ..|....:..|........|..|:...:....|..||||..::|: |::.|:|.:.||.|.....
Mouse    75 ITLDGGAIYEAGKEHGLKPVVGEVYDQDIGTSYYAVAVVRRNSNV-TINTLKGVKSCHTGINRTV 138

  Fly   147 HWTEVLANYFEAAMVS--------------KTCDPEMTVTEDRIASTAKYFGPSCKAGPWVPDPK 197
            .|...:....|:..:|              :.|.|..:... |..:...|||.||..|.......
Mouse   139 GWNVPVGYLVESGHLSVMGCDVLKALCSVPQPCAPSHSPVL-RPTAVGDYFGGSCVPGTGETSHS 202

  Fly   198 QDRILKNRYPSLCEMCYEPDS----CDQT--DKHWGRRGALYCLTSGGGNVAWARLDDVRSHFGF 256
            :         |||.:|....|    ||::  ::::...||..||..|.|:||:.:...|..:...
Mouse   203 E---------SLCRLCRGDSSGHNVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDG 258

  Fly   257 SGIPAQSN---PSDFSYLCPDGHLQPLNASQPCVWVAKPWPVVAARRSHAAQVQRLVTG------ 312
            :.:|:...   ..||..||.||....:...:.|.....|        :||..|:..:.|      
Mouse   259 NTLPSWGKSLMSEDFQLLCRDGSRADITEWRRCHLAKVP--------AHAVVVRGDMDGGLIFQL 315

  Fly   313 -------LNHDEPD---------SWQNALL--SLLETYHVFTVPLDNVIAIDDY---LDQATAFQ 356
                   .:|::..         |.:|.|.  |.||     .||    ||..:|   |.|  .:.
Mouse   316 LNEGQLLFSHEDSSFQMFSSKAYSQKNLLFKDSTLE-----LVP----IATQNYEAWLGQ--EYL 369

  Fly   357 SAYSFPECNP---PRSIVFCTTSIIQHIKCSWLQEASQVYGVQPNIQCVRTMDEQQCLDNTKFKE 418
            .|.....|:|   |..:.:|..|..:..||..:..|.....::|.||||.....:.|::..:...
Mouse   370 QAMKGLLCDPNRLPHYLRWCVLSAPEIQKCGDMAVAFSRQNLKPEIQCVSAESPEHCMEQIQAGH 434

  Fly   419 TDVVLVDQEMRVKAQRDYNLVPLLYEFAA--DMHDRYVTIALVHKDAKFE-SFRDLKGARACLPS 480
            ||.|.:..|...:|.:.|.|||...|..|  |..:.|..:|:..:|:.:. :..:|:|.|:|.|.
Mouse   435 TDAVTLRGEDIYRAGKVYGLVPAAGELYAEEDRSNSYFVVAVARRDSSYSFTLDELRGKRSCHPY 499

  Fly   481 FEGAAHLSVQETIVNATGKVQ--------SLHSYFHRDS----------------CLWNLQSGRK 521
            ....|...|....:...|.::        ::..:|:...                |:.:.:...|
Mouse   500 LGSPAGWEVPIGSLIQRGFIRPKDCDVLTAVSQFFNASCVPVNNPKNYPSALCALCVGDEKGRNK 564

  Fly   522 C----PLHYQGDEGALRCLSEGA-DVAFLSSDVYKKYVVGNLTSNWLTPGNHKDFRVLCPYGGIE 581
            |    ...|.|..||.|||.|.| ||||:......:...|:....|.:....:|:.:|||.|...
Mouse   565 CVGSSQERYYGYSGAFRCLVEHAGDVAFVKHTTVFENTNGHNPEPWASHLRWQDYELLCPNGARA 629

  Fly   582 KRSNFEYCYLHWTTRGHLMTHNSSLTRRNEIYNSLRDMDQLFGRKYKSETRPFTLYGIFDKRNNV 646
            :...|:.|.|     ..:.:|...:                     :.:|..||:||:.||..: 
Mouse   630 EVDQFQACNL-----AQMPSHAVMV---------------------RPDTNIFTVYGLLDKAQD- 667

  Fly   647 LFRDDTDGLLGLQELHRDNAKRVMEHIYDRYANTQYY 683
            ||.||          |..|.       :..:.:::|:
Mouse   668 LFGDD----------HNKNG-------FQMFDSSKYH 687

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 88/404 (22%)
PBP2_transferrin 369..681 CDD:270247 75/344 (22%)
TR_FER 370..656 CDD:214514 73/318 (23%)
MeltfXP_006522295.1 Transferrin 23..377 CDD:278817 81/384 (21%)
PBP2_transferrin 23..375 CDD:270247 81/382 (21%)
TR_FER 387..724 CDD:214514 76/346 (22%)
Periplasmic_Binding_Protein_Type_2 387..721 CDD:304360 76/346 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KI0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11485
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.880

Return to query results.
Submit another query.