DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and Meltf

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_001099342.1 Gene:Meltf RGDID:1308155 Length:738 Species:Rattus norvegicus

Alignment Length:758 Identity:162/759 (21%)
Similarity:266/759 (35%) Gaps:188/759 (25%)


  Fly     1 MQWLTLILVGLFASFLSISMCVAVQPPDDGKLRVCVVESRGVYRKTPKFCPLLEAKSNIECV--I 63
            |||.|                  :..|:..|.:......:|...:....|  ::..|...||  |
  Rat    23 MQWCT------------------ISDPEQQKCKDMSKAFQGAGIQPSLLC--VQGTSTDHCVQLI 67

  Fly    64 GVDRLDCVR----RIHKGTAHFGVLTSEDLVAARWASVEILVASELRSHESHFEYEIVAVVDNHA 124
            ...:.|.:.    .|::....:|:..               |..|:...:....|..||||..::
  Rat    68 KDQKADAITLDGGAIYQAGKEYGLKP---------------VVGEVYDQDIGTSYYAVAVVRRNS 117

  Fly   125 NIHTVHDLRGARLCHPGYGLGNHWTEVLANYFEAAMVS-KTCDPEMTVTEDRIASTAKYFGPSCK 188
            |: |::.|:|.:.||.|......|...:....|...:| ..||.        :.:...|||.||.
  Rat   118 NV-TINTLKGVKSCHTGINRTVGWNVPVGYLVETGHLSVMGCDV--------LKAVGDYFGGSCV 173

  Fly   189 AGPWVPDPKQDRILKNRYPSLCEMCYEPDS----CDQT--DKHWGRRGALYCLTSGGGNVAWARL 247
            .|.......:         |||.:|....|    ||::  ::::...||..||..|.|:||:.:.
  Rat   174 PGAGETSHSE---------SLCRLCRGDSSGHNVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKH 229

  Fly   248 DDVRSHFGFSGIPAQSN---PSDFSYLCPDGHLQPLNASQPCVWVAKPWPVVAARRSHAAQVQRL 309
            ..|..:.....:|:...   ..||..||.||....:...:.|.....|        :||..|:..
  Rat   230 STVLENTDGKTLPSWGKALMSQDFQLLCRDGSRADITEWRRCHLAKVP--------AHAVVVRDD 286

  Fly   310 VTG------LNH------DEPDSWQ----------NALL--SLLETYHVFTVPLDNVIAIDDYLD 350
            :.|      ||.      .|..|:|          |.|.  |.||...:.|...::.:. .:||.
  Rat   287 MDGGLIFRLLNEGQLLFSHEDSSFQMFSSKAYGQKNLLFKDSTLELVPIATQNYESWLG-QEYLH 350

  Fly   351 QATAFQSAYSFPECNP---PRSIVFCTTSIIQHIKCSWLQEASQVYGVQPNIQCVRTMDEQQCLD 412
            ......       |:|   |..:.:|..|:.:..||..:..|.....::|.||||.....:.|:.
  Rat   351 AMKGLL-------CDPNRLPHYLRWCVLSVPEIQKCGDMAVAFSRQSLKPEIQCVSAESPEHCMQ 408

  Fly   413 NTKFKETDVVLVDQEMRVKAQRDYNLVPLLYEFAA--DMHDRYVTIALVHKDAKFE-SFRDLKGA 474
            ..:....|.|.:..|...:|.:.|.|||...|..|  |..:.|..:|:|.:|:.:. :..:|:..
  Rat   409 QIQAGHIDAVTLRGEDIYRAGKAYGLVPAAGELYAEEDRSNSYFVVAVVRRDSSYSFTLDELRSK 473

  Fly   475 RACLPSFEGAAHLSVQETIVNATGKVQ--------SLHSYFHRDS----------------CLWN 515
            |:|.|.....|...|....:...|.::        ::..:|:...                |:.:
  Rat   474 RSCHPGLGSPAGWEVPIGSLIQRGFIRPKDCDVLTAVSEFFNASCVPVNNPKNYPSSLCALCVGD 538

  Fly   516 LQSGRKC----PLHYQGDEGALRCLSEGA-DVAFLSSDVYKKYVVGNLTSNWLTPGNHKDFRVLC 575
            .:...||    ...|.|..||.|||.|.| |||||......:...|:....|.:....:|:.:||
  Rat   539 EKGRNKCVGSSQERYYGYSGAFRCLVENAGDVAFLKHTTVFENTNGHNPEPWASHLRWQDYELLC 603

  Fly   576 PYGGIEKRSNFEYCYLHWTTRGHLMTHNSSLTRRNEIYNSLRDMDQLFGRKYKSETRPFTLYGIF 640
            |.|...:...|:.|.|.......:|.|                          .:|..||:||:.
  Rat   604 PNGARAEVDQFQACNLAQMPSHAVMVH--------------------------PDTNIFTVYGLL 642

  Fly   641 DKRNNVLFRDDTDGLLGLQELHRDNAKRVMEHIYDRYANTQYY 683
            ||..: ||.||          |..|.       :..:.:::|:
  Rat   643 DKAQD-LFGDD----------HNKNG-------FQMFDSSKYH 667

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 79/378 (21%)
PBP2_transferrin 369..681 CDD:270247 76/344 (22%)
TR_FER 370..656 CDD:214514 74/318 (23%)
MeltfNP_001099342.1 PBP2_transferrin 23..355 CDD:270247 82/394 (21%)
Transferrin 24..357 CDD:278817 81/402 (20%)
TR_FER 367..704 CDD:214514 77/346 (22%)
Periplasmic_Binding_Protein_Type_2 367..701 CDD:304360 77/346 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KI0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11485
Phylome 1 0.910 0.857 Consistency score
TreeFam 1 0.960
54.880

Return to query results.
Submit another query.