DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and Tf

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_001013128.1 Gene:Tf RGDID:3845 Length:698 Species:Rattus norvegicus

Alignment Length:788 Identity:174/789 (22%)
Similarity:280/789 (35%) Gaps:232/789 (29%)


  Fly     9 VGLFASFLSISMCVAVQPPDDGKLRVCVVESRGVYRKTPKFCPLLEAKSNIECVIGVDRL----- 68
            ||...:..::.:|:||  ||                ||.|:|.:.| ..|.:|:...|.:     
  Rat     5 VGALLACAALGLCLAV--PD----------------KTVKWCAVSE-HENTKCISFRDHMKTVLP 50

  Fly    69 ---------------DCVRRIHKGTA----------HFGVLTSEDL--VAARWASVEILVASELR 106
                           ||::.|..|.|          :...||..:|  |||.:       ...|.
  Rat    51 ADGPRLACVKKTSYQDCIKAISGGEADAITLDGGWVYDAGLTPNNLKPVAAEF-------YGSLE 108

  Fly   107 SHESHFEYEIVAVVDNHANIHTVHDLRGARLCHPGYGLGNHWTEVLANYFEAAMVSKTCD-PEMT 170
            ..::|  |..||||....:.. ::.|:|.:.||.|.|....|...:...|        |: ||..
  Rat   109 HPQTH--YLAVAVVKKGTDFQ-LNQLQGKKSCHTGLGRSAGWIIPIGLLF--------CNLPEPR 162

  Fly   171 VTEDRIASTAKYFGPSCKAGPWVP--DPKQDRILKNRYPSLCEMCYEPD-SCDQTDKHWGRRGAL 232
            ...::  :.|.:|..||     ||  ||.       .:|.||::|  |. .|..|...:|..||.
  Rat   163 KPLEK--AVASFFSGSC-----VPCADPV-------AFPQLCQLC--PGCGCSPTQPFFGYVGAF 211

  Fly   233 YCLTSGGGNVAWARLDDVRSHFGFSGIPAQSNPSDFSYLCPDGHLQPLNASQPCVWVAKPWPVVA 297
            .||..|||:||:.:...:     |..:|.:::...:..||.|...:|::..:.|.....|...|.
  Rat   212 KCLRDGGGDVAFVKHTTI-----FEVLPQKADRDQYELLCLDNTRKPVDQYEDCYLARIPSHAVV 271

  Fly   298 ARRSHAAQVQRLVTGLNHDEPDSWQNALLSLLET------------YHVFTVPLDNVIAIDDYLD 350
            ||..                 |..::.:..:|:.            :.:|..||...:...|   
  Rat   272 ARNG-----------------DGKEDLIWEILKVAQEHFGKGKSKDFQLFGSPLGKDLLFKD--- 316

  Fly   351 QATAFQSAYSFPECNPPR-------------------------------SIVFCTTSIIQHIKC- 383
                  ||:..... |||                               .:.:|..|..:..|| 
  Rat   317 ------SAFGLLRV-PPRMDYRLYLGHSYVTAIRNQREGVCPEGSIDSAPVKWCALSHQERAKCD 374

  Fly   384 SWLQEASQVYGVQPN--IQCVRTMDEQQCLDNTKFKETDVVLVDQEMRVKAQRDYNLVPLL---Y 443
            .|        .|..|  |:|......:.|:|.....|.|.:.:|......|.: ..|||::   |
  Rat   375 EW--------SVSSNGQIECESAESTEDCIDKIVNGEADAMSLDGGHAYIAGQ-CGLVPVMAENY 430

  Fly   444 EFA------ADMHDR-YVTIALVHKDAKFESFRDLKGARACLPSFEGAAHLSVQETI-------- 493
            :.:      :|:..: |..:|:|.......::.:|||.::|        |..|..|.        
  Rat   431 DISSCTNPQSDVFPKGYYAVAVVKASDSSINWNNLKGKKSC--------HTGVDRTAGWNIPMGL 487

  Fly   494 ----VNATGKVQSLHSY-----FHRDSCLWNLQSG-RKCPLH----YQGDEGALRCLSEGADVAF 544
                :|.. |.....|.     :.::|.|.:|..| .||..:    |.|..||.:||.|..||||
  Rat   488 LFSRINHC-KFDEFFSQGCAPGYKKNSTLCDLCIGPAKCAPNNREGYNGYTGAFQCLVEKGDVAF 551

  Fly   545 LSSDVYKKYVVGNLTSNWLTPGNHKDFRVLCPYGGIEKRSNFEYCYLHWTTRGHLMTHNSSLTRR 609
            :......:...|..|:.|......:||::|||.|..:..:.|..|:|.......:::......|.
  Rat   552 VKHQTVLENTNGKNTAAWAKDLKQEDFQLLCPDGTKKPVTEFATCHLAQAPNHVVVSRKEKAARV 616

  Fly   610 NEIYNSLRDMDQLFGRKYKSETRPFTLYGIFDKRNNVLFRDDTDGLLGLQELHRDNAKRVMEHIY 674
            :.:..:.:|   ||.:..|..|..|.|:....|  ::||||||..|..|.|          ...|
  Rat   617 STVLTAQKD---LFWKGDKDCTGNFCLFRSSTK--DLLFRDDTKCLTKLPE----------GTTY 666

  Fly   675 DRYANTQY 682
            :.|...:|
  Rat   667 EEYLGAEY 674

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 83/383 (22%)
PBP2_transferrin 369..681 CDD:270247 82/347 (24%)
TR_FER 370..656 CDD:214514 78/321 (24%)
TfNP_001013128.1 PBP2_transferrin_N 24..346 CDD:270336 83/389 (21%)
Transferrin 25..347 CDD:278817 82/389 (21%)
PBP2_transferrin_C 357..682 CDD:270335 83/352 (24%)
TR_FER 360..683 CDD:214514 83/349 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11485
Phylome 1 0.910 0.857 Consistency score
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.