DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsf3 and Trf

Sequence 1:NP_523759.1 Gene:Tsf3 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_598738.1 Gene:Trf MGIID:98821 Length:697 Species:Mus musculus

Alignment Length:807 Identity:176/808 (22%)
Similarity:288/808 (36%) Gaps:226/808 (28%)


  Fly     7 ILVGLFASFLSISMCVAVQPPDDGKLRVCVVESRGVYRKTPKFCPLLEAKSNIECVIGVD----- 66
            :.||...:..::.:|:||  ||                ||.|:|.:.| ..|.:|:...|     
Mouse     3 LTVGALLACAALGLCLAV--PD----------------KTVKWCAVSE-HENTKCISFRDHMKTV 48

  Fly    67 ------RLDCVRR-------------------IHKGTAHFGVLTSEDL--VAAR-WASVEILVAS 103
                  ||.||::                   :..|..:...||..:|  |||. :.|||     
Mouse    49 LPPDGPRLACVKKTSYPDCIKAISASEADAMTLDGGWVYDAGLTPNNLKPVAAEFYGSVE----- 108

  Fly   104 ELRSHESHFEYEIVAVVDNHANIHTVHDLRGARLCHPGYGLGNHWTEVLANYFEAAMVSKTCDPE 168
                |...: |..||||....:.. ::.|.|.:.||.|.|....|...:...|     .|..:|.
Mouse   109 ----HPQTY-YYAVAVVKKGTDFQ-LNQLEGKKSCHTGLGRSAGWVIPIGLLF-----CKLSEPR 162

  Fly   169 MTVTEDRIASTAKYFGPSCKAGPWVP--DPKQDRILKNRYPSLCEMCYEPD-SCDQTDKHWGRRG 230
            ..:.:    :.:.:|..||     ||  ||.       .:|.||::|  |. .|..|...:|..|
Mouse   163 SPLEK----AVSSFFSGSC-----VPCADPV-------AFPKLCQLC--PGCGCSSTQPFFGYVG 209

  Fly   231 ALYCLTSGGGNVAWARLDDVRSHFGFSGIPAQSNPSDFSYLCPDGHLQPLNASQPCVWVAKPWPV 295
            |..||..|||:||:.:...:     |..:|.:::...:..||.|...:|::..:.|.....|...
Mouse   210 AFKCLKDGGGDVAFVKHTTI-----FEVLPEKADRDQYELLCLDNTRKPVDQYEDCYLARIPSHA 269

  Fly   296 VAARRSHAAQVQRLVTGLNHDEPDSWQNALLSLLE---------TYHVFTVPLDNVIAIDD---- 347
            |.||::            |..|...|:  :|.:.:         .:.:|:.||...:...|    
Mouse   270 VVARKN------------NGKEDLIWE--ILKVAQEHFGKGKSKDFQLFSSPLGKDLLFKDSAFG 320

  Fly   348 ------------YL--DQATAFQSAYS--FPECNPPRS-IVFCTTSIIQHIKC-SW--LQEASQV 392
                        ||  :..||.::...  .||.:...| :.:|..|.::..|| .|  :.|.   
Mouse   321 LLRVPPRMDYRLYLGHNYVTAIRNQQEGVCPEGSIDNSPVKWCALSHLERTKCDEWSIISEG--- 382

  Fly   393 YGVQPNIQCVRTMDEQQCLDNTKFKETDVVLVDQEMRVKAQRDYNLVPLLYEFAADMH------- 450
                 .|:|......:.|::.....|.|.:.:|......|.: ..|||::.|:....:       
Mouse   383 -----KIECESAETTEDCIEKIVNGEADAMTLDGGHAYIAGQ-CGLVPVMAEYYESSNCAIPSQQ 441

  Fly   451 ----DRYVTIALVHKDAKFESFRDLKGARACLPSFEGAAHLSVQET---------IVNATG--KV 500
                ..|..:|:|.......::.:|||.::|        |..|..|         :.|...  |.
Mouse   442 GIFPKGYYAVAVVKASDTSITWNNLKGKKSC--------HTGVDRTAGWNIPMGMLYNRINHCKF 498

  Fly   501 QSLHSY-----FHRDSCLWNLQSG-RKCPLH----YQGDEGALRCLSEGADVAFLSSDVYKKYVV 555
            ....|.     :.::|.|.:|..| .||..:    |.|..||.|||.|..||||:..........
Mouse   499 DEFFSQGCAPGYEKNSTLCDLCIGPLKCAPNNKEEYNGYTGAFRCLVEKGDVAFVKHQTVLDNTE 563

  Fly   556 GNLTSNWLTPGNHKDFRVLCPYGGIEKRSNFEYCYLHWTTRGHLMTHNSSLTRRNEIYNSLRDMD 620
            |...:.|......:||.:|||.|..:...:|..|:|.......:::......|...:   |...:
Mouse   564 GKNPAEWAKNLKQEDFELLCPDGTRKPVKDFASCHLAQAPNHVVVSRKEKAARVKAV---LTSQE 625

  Fly   621 QLFGRK--------YKSETRPFTLYGIFDKRNNVLFRDDTDGLLGLQELHRDNAKRVMEHIYDRY 677
            .|||..        :||.|:            ::||||||...:.|.|          ....::|
Mouse   626 TLFGGSDCTGNFCLFKSTTK------------DLLFRDDTKCFVKLPE----------GTTPEKY 668

  Fly   678 ANTQYYRNFDESGAMKSSHNLWILLVC 704
            ...:|.::.   |.|:......:|..|
Mouse   669 LGAEYMQSV---GNMRKCSTSRLLEAC 692

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 87/400 (22%)
PBP2_transferrin 369..681 CDD:270247 77/356 (22%)
TR_FER 370..656 CDD:214514 73/329 (22%)
TrfNP_598738.1 PBP2_transferrin_N 24..344 CDD:270336 84/374 (22%)
Transferrin 25..347 CDD:278817 83/376 (22%)
PBP2_transferrin_C 359..681 CDD:270335 79/367 (22%)
TR_FER 360..682 CDD:214514 79/367 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28KI0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11485
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.880

Return to query results.
Submit another query.